3QB4 - JenaLib

Asymmetric Unit (18, 36)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_064416	R	399	C	GDF5_HUMAN	Disease (BDA1C)	---	A/C	R	18	C
02	UniProt	VAR_017407	C	400	Y	GDF5_HUMAN	Disease (AMDG)	---	A/C	C	19	Y
03	UniProt	VAR_073141	W	414	R	GDF5_HUMAN	Disease (SYNS2)	---	A/C	W	33	R
04	UniProt	VAR_041398	F	58	Y	BMR1A_HUMAN	Unclassified	---	B/D	F	35	Y
05	UniProt	VAR_022828	Y	62	D	BMR1A_HUMAN	Disease (JPS)	---	B/D	Y	39	D
06	UniProt	VAR_054911	P	436	T	GDF5_HUMAN	Disease (DPS)	---	A/C	P	55	T
07	UniProt	VAR_026545	R	438	L	GDF5_HUMAN	Disease (SYM1B)	---	A/C	A	57	L
08	UniProt	VAR_037980	S	439	T	GDF5_HUMAN	Disease (DPS)	---	A/C	S	58	T
09	UniProt	VAR_037981	H	440	L	GDF5_HUMAN	Disease (DPS)	---	A/C	H	59	L
10	UniProt	VAR_022829	C	82	Y	BMR1A_HUMAN	Disease (JPS)	---	B/D	C	59	Y
11	UniProt	VAR_017408	L	441	P	GDF5_HUMAN	Disease (SYNS2)	28936683	A/C	L	60	P
12	UniProt	VAR_073142	N	445	K	GDF5_HUMAN	Disease (SYNS2)	---	A/C	N	64	K
13	UniProt	VAR_073143	N	445	T	GDF5_HUMAN	Disease (SYNS2)	---	A/C	N	64	T
14	UniProt	VAR_037982	S	475	N	GDF5_HUMAN	Disease (SYNS2)	---	A/C	S	94	N
15	UniProt	VAR_015533	C	124	R	BMR1A_HUMAN	Disease (JPS)	199476087	B/D	C	101	R
16	UniProt	VAR_074162	V	486	M	GDF5_HUMAN	Disease (BDC)	---	A/C	V	105	M
17	UniProt	VAR_022830	C	130	R	BMR1A_HUMAN	Disease (JPS)	---	B/D	C	107	R
18	UniProt	VAR_037983	E	491	K	GDF5_HUMAN	Disease (SYM1B)	---	A/C	E	110	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (18, 18)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_064416	R	399	C	GDF5_HUMAN	Disease (BDA1C)	---	A	R	18	C
02	UniProt	VAR_017407	C	400	Y	GDF5_HUMAN	Disease (AMDG)	---	A	C	19	Y
03	UniProt	VAR_073141	W	414	R	GDF5_HUMAN	Disease (SYNS2)	---	A	W	33	R
04	UniProt	VAR_041398	F	58	Y	BMR1A_HUMAN	Unclassified	---	B	F	35	Y
05	UniProt	VAR_022828	Y	62	D	BMR1A_HUMAN	Disease (JPS)	---	B	Y	39	D
06	UniProt	VAR_054911	P	436	T	GDF5_HUMAN	Disease (DPS)	---	A	P	55	T
07	UniProt	VAR_026545	R	438	L	GDF5_HUMAN	Disease (SYM1B)	---	A	A	57	L
08	UniProt	VAR_037980	S	439	T	GDF5_HUMAN	Disease (DPS)	---	A	S	58	T
09	UniProt	VAR_037981	H	440	L	GDF5_HUMAN	Disease (DPS)	---	A	H	59	L
10	UniProt	VAR_022829	C	82	Y	BMR1A_HUMAN	Disease (JPS)	---	B	C	59	Y
11	UniProt	VAR_017408	L	441	P	GDF5_HUMAN	Disease (SYNS2)	28936683	A	L	60	P
12	UniProt	VAR_073142	N	445	K	GDF5_HUMAN	Disease (SYNS2)	---	A	N	64	K
13	UniProt	VAR_073143	N	445	T	GDF5_HUMAN	Disease (SYNS2)	---	A	N	64	T
14	UniProt	VAR_037982	S	475	N	GDF5_HUMAN	Disease (SYNS2)	---	A	S	94	N
15	UniProt	VAR_015533	C	124	R	BMR1A_HUMAN	Disease (JPS)	199476087	B	C	101	R
16	UniProt	VAR_074162	V	486	M	GDF5_HUMAN	Disease (BDC)	---	A	V	105	M
17	UniProt	VAR_022830	C	130	R	BMR1A_HUMAN	Disease (JPS)	---	B	C	107	R
18	UniProt	VAR_037983	E	491	K	GDF5_HUMAN	Disease (SYM1B)	---	A	E	110	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (18, 18)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_064416	R	399	C	GDF5_HUMAN	Disease (BDA1C)	---	C	R	18	C
02	UniProt	VAR_017407	C	400	Y	GDF5_HUMAN	Disease (AMDG)	---	C	C	19	Y
03	UniProt	VAR_073141	W	414	R	GDF5_HUMAN	Disease (SYNS2)	---	C	W	33	R
04	UniProt	VAR_041398	F	58	Y	BMR1A_HUMAN	Unclassified	---	D	F	35	Y
05	UniProt	VAR_022828	Y	62	D	BMR1A_HUMAN	Disease (JPS)	---	D	Y	39	D
06	UniProt	VAR_054911	P	436	T	GDF5_HUMAN	Disease (DPS)	---	C	P	55	T
07	UniProt	VAR_026545	R	438	L	GDF5_HUMAN	Disease (SYM1B)	---	C	A	57	L
08	UniProt	VAR_037980	S	439	T	GDF5_HUMAN	Disease (DPS)	---	C	S	58	T
09	UniProt	VAR_037981	H	440	L	GDF5_HUMAN	Disease (DPS)	---	C	H	59	L
10	UniProt	VAR_022829	C	82	Y	BMR1A_HUMAN	Disease (JPS)	---	D	C	59	Y
11	UniProt	VAR_017408	L	441	P	GDF5_HUMAN	Disease (SYNS2)	28936683	C	L	60	P
12	UniProt	VAR_073142	N	445	K	GDF5_HUMAN	Disease (SYNS2)	---	C	N	64	K
13	UniProt	VAR_073143	N	445	T	GDF5_HUMAN	Disease (SYNS2)	---	C	N	64	T
14	UniProt	VAR_037982	S	475	N	GDF5_HUMAN	Disease (SYNS2)	---	C	S	94	N
15	UniProt	VAR_015533	C	124	R	BMR1A_HUMAN	Disease (JPS)	199476087	D	C	101	R
16	UniProt	VAR_074162	V	486	M	GDF5_HUMAN	Disease (BDC)	---	C	V	105	M
17	UniProt	VAR_022830	C	130	R	BMR1A_HUMAN	Disease (JPS)	---	D	C	107	R
18	UniProt	VAR_037983	E	491	K	GDF5_HUMAN	Disease (SYM1B)	---	C	E	110	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (18, 36)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_064416	R	399	C	GDF5_HUMAN	Disease (BDA1C)	---	A/C	R	18	C
02	UniProt	VAR_017407	C	400	Y	GDF5_HUMAN	Disease (AMDG)	---	A/C	C	19	Y
03	UniProt	VAR_073141	W	414	R	GDF5_HUMAN	Disease (SYNS2)	---	A/C	W	33	R
04	UniProt	VAR_041398	F	58	Y	BMR1A_HUMAN	Unclassified	---	B/D	F	35	Y
05	UniProt	VAR_022828	Y	62	D	BMR1A_HUMAN	Disease (JPS)	---	B/D	Y	39	D
06	UniProt	VAR_054911	P	436	T	GDF5_HUMAN	Disease (DPS)	---	A/C	P	55	T
07	UniProt	VAR_026545	R	438	L	GDF5_HUMAN	Disease (SYM1B)	---	A/C	A	57	L
08	UniProt	VAR_037980	S	439	T	GDF5_HUMAN	Disease (DPS)	---	A/C	S	58	T
09	UniProt	VAR_037981	H	440	L	GDF5_HUMAN	Disease (DPS)	---	A/C	H	59	L
10	UniProt	VAR_022829	C	82	Y	BMR1A_HUMAN	Disease (JPS)	---	B/D	C	59	Y
11	UniProt	VAR_017408	L	441	P	GDF5_HUMAN	Disease (SYNS2)	28936683	A/C	L	60	P
12	UniProt	VAR_073142	N	445	K	GDF5_HUMAN	Disease (SYNS2)	---	A/C	N	64	K
13	UniProt	VAR_073143	N	445	T	GDF5_HUMAN	Disease (SYNS2)	---	A/C	N	64	T
14	UniProt	VAR_037982	S	475	N	GDF5_HUMAN	Disease (SYNS2)	---	A/C	S	94	N
15	UniProt	VAR_015533	C	124	R	BMR1A_HUMAN	Disease (JPS)	199476087	B/D	C	101	R
16	UniProt	VAR_074162	V	486	M	GDF5_HUMAN	Disease (BDC)	---	A/C	V	105	M
17	UniProt	VAR_022830	C	130	R	BMR1A_HUMAN	Disease (JPS)	---	B/D	C	107	R
18	UniProt	VAR_037983	E	491	K	GDF5_HUMAN	Disease (SYM1B)	---	A/C	E	110	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 2)

Exons (4, 8)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:105
 aligned with GDF5_HUMAN | P43026 from UniProtKB/Swiss-Prot  Length:501

    Alignment length:105
                                   406       416       426       436       446       456       466       476       486       496     
           GDF5_HUMAN   397 KARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR 501
               SCOP domains d3qb4a_ A: automated matches                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..eee.........eee..eee..eee.......hhhhh.hhhhhhhhhhhhhh.......eeeeeeeeeeeeee.......eeeeeeeeeeeeeeee Sec.struct. author
             SAPs(SNPs) (1) --CY-------------R---------------------T-LTLP---K-----------------------------N----------M----K---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------T-------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ---------------------TGF_BETA_1      -------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.4  PDB: A:16-120 UniProt: 211-501 [INCOMPLETE]                                                     Transcript 2
                 3qb4 A  16 KARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLASHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR 120
                                    25        35        45        55        65        75        85        95       105       115

Chain B from PDB  Type:PROTEIN  Length:88
 aligned with BMR1A_HUMAN | P36894 from UniProtKB/Swiss-Prot  Length:532

    Alignment length:88
                                    63        73        83        93       103       113       123       133        
          BMR1A_HUMAN    54 DTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 141
               SCOP domains d3qb4b_ B: BMP receptor Ia ectodomain                                                    SCOP domains
               CATH domains ---------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee............eeee..eeeeeeee.....eeeeeeee...hhhhhhh........eeeeee................ Sec.struct. author
                 SAPs(SNPs) ----Y---D-------------------Y-----------------------------------------R-----R----------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: B:31-54 ----------------------------------Exon 1.7  PDB: B:89-118        Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.6  PDB: B:54-88             ------------------------------ Transcript 1 (2)
                 3qb4 B  31 DTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 118
                                    40        50        60        70        80        90       100       110

Chain C from PDB  Type:PROTEIN  Length:106
 aligned with GDF5_HUMAN | P43026 from UniProtKB/Swiss-Prot  Length:501

    Alignment length:106
                                   405       415       425       435       445       455       465       475       485       495      
           GDF5_HUMAN   396 LKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR 501
               SCOP domains d3qb4c_ C: automated matches                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..eee.........eee..eee..eee.......hhhhh.hhhhhhhhhhhhhh.......eeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee Sec.struct. author
             SAPs(SNPs) (1) ---CY-------------R---------------------T-LTLP---K-----------------------------N----------M----K---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------T-------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------TGF_BETA_1      -------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.4  PDB: C:15-120 UniProt: 211-501 [INCOMPLETE]                                                      Transcript 2
                 3qb4 C  15 LKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLASHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR 120
                                    24        34        44        54        64        74        84        94       104       114

Chain D from PDB  Type:PROTEIN  Length:89
 aligned with BMR1A_HUMAN | P36894 from UniProtKB/Swiss-Prot  Length:532

    Alignment length:89
                                    63        73        83        93       103       113       123       133         
          BMR1A_HUMAN    54 DTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVV 142
               SCOP domains d3qb4d_ D: BMP receptor Ia ectodomain                                                     SCOP domains
               CATH domains ----------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee............eeee..eeeeeeee.....eeeeeeee...hhhhhhhh.......eeeeee...hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ----Y---D-------------------Y-----------------------------------------R-----R------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5c  PDB: D:31-54 ----------------------------------Exon 1.7  PDB: D:89-119         Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.6  PDB: D:54-88             ------------------------------- Transcript 1 (2)
                 3qb4 D  31 DTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVV 119
                                    40        50        60        70        80        90       100       110

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (104, 113)

Asymmetric Unit(hide GO term definitions)

Chain A,C (GDF5_HUMAN | P43026)

molecular function
	GO:0036122	BMP binding	Interacting selectively and non-covalently with a member of the bone morphogenetic protein (BMP) family.
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005160	transforming growth factor beta receptor binding	Interacting selectively and non-covalently with the transforming growth factor beta receptor.
biological process
	GO:0007184	SMAD protein import into nucleus	The directed movement of a SMAD proteins from the cytoplasm into the nucleus. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
	GO:0060395	SMAD protein signal transduction	The cascade of processes by which a signal interacts with a receptor, causing a change in the activity of a SMAD protein, and ultimately effecting a change in the functioning of the cell.
	GO:0051216	cartilage development	The process whose specific outcome is the progression of a cartilage element over time, from its formation to the mature structure. Cartilage elements are skeletal elements that consist of connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
	GO:0048468	cell development	The process whose specific outcome is the progression of the cell over time, from its formation to the mature structure. Cell development does not include the steps involved in committing a cell to a specific fate.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0060591	chondroblast differentiation	The process in which a mesenchymal cell, acquires specialized structural and/or functional features of a chondroblast. Differentiation includes the processes involved in commitment of a cell to a chondroblast fate. A chondroblast is a precursor cell to chondrocytes.
	GO:0002062	chondrocyte differentiation	The process in which a chondroblast acquires specialized structural and/or functional features of a chondrocyte. A chondrocyte is a polymorphic cell that forms cartilage.
	GO:0030326	embryonic limb morphogenesis	The process, occurring in the embryo, by which the anatomical structures of the limb are generated and organized. A limb is an appendage of an animal used for locomotion or grasping.
	GO:0035136	forelimb morphogenesis	The process in which the anatomical structures of the forelimb are generated and organized. The forelimbs are the front limbs of an animal, e.g. the arms of a human.
	GO:0040007	growth	The increase in size or mass of an entire organism, a part of an organism or a cell.
	GO:0035137	hindlimb morphogenesis	The process in which the anatomical structures of the hindlimb are generated and organized.
	GO:0032331	negative regulation of chondrocyte differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of chondrocyte differentiation.
	GO:0050680	negative regulation of epithelial cell proliferation	Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
	GO:2001054	negative regulation of mesenchymal cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of mesenchymal cell apoptotic process.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0030513	positive regulation of BMP signaling pathway	Any process that activates or increases the frequency, rate or extent of BMP signaling pathway activity.
	GO:0032332	positive regulation of chondrocyte differentiation	Any process that activates or increases the frequency, rate or extent of chondrocyte differentiation.
	GO:0098779	positive regulation of macromitophagy in response to mitochondrial depolarization	The macromitophagy process that is triggered by a detection of the loss of mitochondrial membrane potential.
	GO:0045666	positive regulation of neuron differentiation	Any process that activates or increases the frequency, rate or extent of neuron differentiation.
	GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
	GO:0043408	regulation of MAPK cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:0040014	regulation of multicellular organism growth	Any process that modulates the frequency, rate or extent of growth of the body of an organism so that it reaches its usual body size.
	GO:0007179	transforming growth factor beta receptor signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0007178	transmembrane receptor protein serine/threonine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses serine/threonine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B,D (BMR1A_HUMAN | P36894)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0098821	BMP receptor activity	Combining with a member of the bone morphogenetic protein (BMP) family, and transmitting a signal across the plasma membrane to initiate a change in cell activity.
	GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0046332	SMAD binding	Interacting selectively and non-covalently with a SMAD signaling protein.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0004702	signal transducer, downstream of receptor, with serine/threonine kinase activity	Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004675	transmembrane receptor protein serine/threonine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
biological process
	GO:0030509	BMP signaling pathway	A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0001880	Mullerian duct regression	The process in which the Mullerian ducts, primordia of the oviducts, uterus and upper vagina, undergo regression in male embryos.
	GO:0009952	anterior/posterior pattern specification	The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
	GO:0051216	cartilage development	The process whose specific outcome is the progression of a cartilage element over time, from its formation to the mature structure. Cartilage elements are skeletal elements that consist of connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0071773	cellular response to BMP stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
	GO:0002062	chondrocyte differentiation	The process in which a chondroblast acquires specialized structural and/or functional features of a chondrocyte. A chondrocyte is a polymorphic cell that forms cartilage.
	GO:0048589	developmental growth	The increase in size or mass of an entire organism, a part of an organism or a cell, where the increase in size or mass has the specific outcome of the progression of the organism over time from one condition to another.
	GO:0009950	dorsal/ventral axis specification	The establishment, maintenance and elaboration of the dorsal/ventral axis. The dorsal/ventral axis is defined by a line that runs orthogonal to both the anterior/posterior and left/right axes. The dorsal end is defined by the upper or back side of an organism. The ventral end is defined by the lower or front side of an organism.
	GO:0009953	dorsal/ventral pattern formation	The regionalization process in which the areas along the dorsal/ventral axis are established that will lead to differences in cell differentiation. The dorsal/ventral axis is defined by a line that runs orthogonal to both the anterior/posterior and left/right axes. The dorsal end is defined by the upper or back side of an organism. The ventral end is defined by the lower or front side of an organism.
	GO:0007398	ectoderm development	The process whose specific outcome is the progression of the ectoderm over time, from its formation to the mature structure. In animal embryos, the ectoderm is the outer germ layer of the embryo, formed during gastrulation.
	GO:0042733	embryonic digit morphogenesis	The process, occurring in the embryo, by which the anatomical structures of the digit are generated and organized. A digit is one of the terminal divisions of an appendage, such as a finger or toe.
	GO:0048598	embryonic morphogenesis	The process in which anatomical structures are generated and organized during the embryonic phase. The embryonic phase begins with zygote formation. The end of the embryonic phase is organism-specific. For example, it would be at birth for mammals, larval hatching for insects and seed dormancy in plants.
	GO:0048568	embryonic organ development	Development, taking place during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Development pertains to the process whose specific outcome is the progression of a structure over time, from its formation to the mature structure. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
	GO:0003272	endocardial cushion formation	The developmental process pertaining to the initial formation of an endocardial cushion. The endocardial cushion is a specialized region of mesenchymal cells that will give rise to the heart septa and valves.
	GO:0007492	endoderm development	The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0060914	heart formation	The developmental process pertaining to the initial formation of the heart from unspecified parts. This process begins with the specific processes that contribute to the appearance of the heart field and the arrival of cardiac neural crest to the heart region. The process ends when the structural rudiment is recognizable.
	GO:0003007	heart morphogenesis	The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0035137	hindlimb morphogenesis	The process in which the anatomical structures of the hindlimb are generated and organized.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0001701	in utero embryonic development	The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
	GO:0048368	lateral mesoderm development	The process whose specific outcome is the progression of the lateral mesoderm over time, from its formation to the mature structure.
	GO:0030324	lung development	The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
	GO:0048382	mesendoderm development	The process whose specific outcome is the progression of the mesendoderm over time, from its formation to the mature structure. In animal embryos, mesendoderm development gives rise to both mesoderm and endoderm tissues.
	GO:0001707	mesoderm formation	The process that gives rise to the mesoderm. This process pertains to the initial formation of the structure from unspecified parts.
	GO:0050768	negative regulation of neurogenesis	Any process that stops, prevents, or reduces the frequency, rate or extent of neurogenesis, the origin and formation of neurons.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0014032	neural crest cell development	The process aimed at the progression of a neural crest cell over time, from initial commitment of the cell to its specific fate, to the fully functional differentiated cell.
	GO:0021998	neural plate mediolateral regionalization	The process that regulates the coordinated growth and differentiation that establishes the non-random mediolateral spatial arrangement of the neural plate.
	GO:0060896	neural plate pattern specification	The developmental process that results in the creation of defined areas or spaces within the neural plate to which cells respond and eventually are instructed to differentiate.
	GO:0042475	odontogenesis of dentin-containing tooth	The process whose specific outcome is the progression of a dentin-containing tooth over time, from its formation to the mature structure. A dentin-containing tooth is a hard, bony organ borne on the jaw or other bone of a vertebrate, and is composed mainly of dentin, a dense calcified substance, covered by a layer of enamel.
	GO:0060021	palate development	The biological process whose specific outcome is the progression of the palate from an initial condition to its mature state. This process begins with the formation of the structure and ends with the mature structure. The palate is the partition that separates the nasal and oral cavities.
	GO:0048339	paraxial mesoderm development	The process whose specific outcome is the progression of the paraxial mesoderm over time, from its formation to the mature structure. The paraxial mesoderm is the mesoderm located bilaterally adjacent to the notochord and neural tube.
	GO:0048352	paraxial mesoderm structural organization	The process that contributes to the act of creating the structural organization of the paraxial mesoderm. This process pertains to the physical shaping of a rudimentary structure.
	GO:0007389	pattern specification process	Any developmental process that results in the creation of defined areas or spaces within an organism to which cells respond and eventually are instructed to differentiate.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0021983	pituitary gland development	The progression of the pituitary gland over time from its initial formation until its mature state. The pituitary gland is an endocrine gland that secretes hormones that regulate many other glands.
	GO:0060391	positive regulation of SMAD protein import into nucleus	Any process that increases the rate, frequency or extent of SMAD protein import into the nucleus, i.e. the directed movement of a SMAD proteins from the cytoplasm into the nucleus. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
	GO:0030501	positive regulation of bone mineralization	Any process that activates or increases the frequency, rate or extent of bone mineralization.
	GO:0050679	positive regulation of epithelial cell proliferation	Any process that activates or increases the rate or extent of epithelial cell proliferation.
	GO:0002053	positive regulation of mesenchymal cell proliferation	The process of activating or increasing the rate or extent of mesenchymal cell proliferation. Mesenchymal cells are loosely organized embryonic cells.
	GO:0045669	positive regulation of osteoblast differentiation	Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
	GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:2000772	regulation of cellular senescence	Any process that modulates the frequency, rate or extent of cellular senescence.
	GO:0048378	regulation of lateral mesodermal cell fate specification	Any process that modulates the frequency, rate or extent of lateral mesoderm cell fate specification.
	GO:0023014	signal transduction by protein phosphorylation	A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
	GO:0001756	somitogenesis	The formation of mesodermal clusters that are arranged segmentally along the anterior posterior axis of an embryo.
	GO:0019827	stem cell population maintenance	The process by which an organism or tissue maintains a population of stem cells of a single type. This can be achieved by a number of mechanisms: stem cell asymmetric division maintains stem cell numbers; stem cell symmetric division increases them; maintenance of a stem cell niche maintains the conditions for commitment to the stem cell fate for some types of stem cell; stem cells may arise de novo from other cell types.
	GO:0007179	transforming growth factor beta receptor signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0007178	transmembrane receptor protein serine/threonine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses serine/threonine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:1990712	HFE-transferrin receptor complex	A protein complex containing at least HFE and a transferrin receptor (either TFR1/TFRC or TFR2), proposed to play a role in the sensing of transferrin-bound Fe (Fe2-Tf) on the plasma membrane to regulate hepcidin transcription.
	GO:0005901	caveola	A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (17, 17)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (18, 36)

PROSITE Motifs (1, 2)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (104, 113)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File