Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE NEUTRALIZING FAB FRAGMENT ABD1556 BOUND TO THE BMP TYPE I RECEPTOR IA
 
Authors :  T. D. Mueller, S. Harth, W. Sebald
Date :  14 Jun 10  (Deposition) - 27 Oct 10  (Release) - 27 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D,H,I,J,K,L,M,N,O
Biol. Unit 1:  A,H,L  (1x)
Biol. Unit 2:  B,I,M  (1x)
Biol. Unit 3:  C,J,N  (1x)
Biol. Unit 4:  D,K,O  (1x)
Keywords :  Antibody-Antigen Complex, Bmp Receptor Extracellular Domain, Bone Morphogenetic Protein, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Harth, A. Kotzsch, J. Hu, W. Sebald, T. D. Mueller
A Selection Fit Mechanism In Bmp Receptor Ia As A Possible Source For Bmp Ligand-Receptor Promiscuity
Plos One V. 5 E1304 2010
PubMed-ID: 20927405  |  Reference-DOI: 10.1371/JOURNAL.PONE.0013049

(-) Compounds

Molecule 1 - ANTIBODY FRAGMENT FAB ABD1556, HEAVY CHAIN
    ChainsH, I, J, K
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 2 - ANTIBODY FRAGMENT FAB ABD1556, LIGHT CHAIN
    ChainsL, M, N, O
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 3 - BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-1A
    ChainsA, B, C, D
    EC Number2.7.11.30
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET32A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentEXTRACELLULAR DOMAIN, UNP RESIDUES 24-152
    GeneBMPR1A
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBMP TYPE I RECEPTOR, BMPR-IA, BMP TYPE-1A RECEPTOR, BMPR-1A, SERINE/THREONINE-PROTEIN KINASE RECEPTOR R5, SKR5, ACTIVIN RECEPTOR- LIKE KINASE 3, ALK-3

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDHIJKLMNO
Biological Unit 1 (1x)A   H   L   
Biological Unit 2 (1x) B   I   M  
Biological Unit 3 (1x)  C   J   N 
Biological Unit 4 (1x)   D   K   O

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3NH7)

(-) Sites  (0, 0)

(no "Site" information available for 3NH7)

(-) SS Bonds  (36, 36)

Asymmetric Unit
No.Residues
1A:38 -A:59
2A:40 -A:44
3A:53 -A:77
4A:87 -A:101
5A:102 -A:107
6B:38 -B:59
7B:40 -B:44
8B:53 -B:77
9B:87 -B:101
10B:102 -B:107
11C:38 -C:59
12C:40 -C:44
13C:53 -C:77
14C:87 -C:101
15C:102 -C:107
16D:38 -D:59
17D:40 -D:44
18D:53 -D:77
19D:87 -D:101
20D:102 -D:107
21H:22 -H:96
22H:147 -H:203
23I:22 -I:96
24I:147 -I:203
25J:22 -J:96
26J:147 -J:203
27K:22 -K:96
28K:147 -K:203
29L:22 -L:87
30L:136 -L:195
31M:22 -M:87
32M:136 -M:195
33N:22 -N:87
34N:136 -N:195
35O:22 -O:87
36O:136 -O:195

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Phe H:153 -Pro H:154
2Glu H:155 -Pro H:156
3Tyr L:142 -Pro L:143
4Phe I:153 -Pro I:154
5Glu I:155 -Pro I:156
6Tyr M:142 -Pro M:143
7Phe J:153 -Pro J:154
8Glu J:155 -Pro J:156
9Tyr N:142 -Pro N:143
10Phe K:153 -Pro K:154
11Glu K:155 -Pro K:156
12Tyr O:142 -Pro O:143

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (5, 20)

Asymmetric Unit (5, 20)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041398F58YBMR1A_HUMANUnclassified  ---A/B/C/DF35Y
2UniProtVAR_022828Y62DBMR1A_HUMANDisease (JPS)  ---A/B/C/DY39D
3UniProtVAR_022829C82YBMR1A_HUMANDisease (JPS)  ---A/B/C/DC59Y
4UniProtVAR_015533C124RBMR1A_HUMANDisease (JPS)199476087A/B/C/DC101R
5UniProtVAR_022830C130RBMR1A_HUMANDisease (JPS)  ---A/B/C/DC107R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041398F58YBMR1A_HUMANUnclassified  ---AF35Y
2UniProtVAR_022828Y62DBMR1A_HUMANDisease (JPS)  ---AY39D
3UniProtVAR_022829C82YBMR1A_HUMANDisease (JPS)  ---AC59Y
4UniProtVAR_015533C124RBMR1A_HUMANDisease (JPS)199476087AC101R
5UniProtVAR_022830C130RBMR1A_HUMANDisease (JPS)  ---AC107R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041398F58YBMR1A_HUMANUnclassified  ---BF35Y
2UniProtVAR_022828Y62DBMR1A_HUMANDisease (JPS)  ---BY39D
3UniProtVAR_022829C82YBMR1A_HUMANDisease (JPS)  ---BC59Y
4UniProtVAR_015533C124RBMR1A_HUMANDisease (JPS)199476087BC101R
5UniProtVAR_022830C130RBMR1A_HUMANDisease (JPS)  ---BC107R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041398F58YBMR1A_HUMANUnclassified  ---CF35Y
2UniProtVAR_022828Y62DBMR1A_HUMANDisease (JPS)  ---CY39D
3UniProtVAR_022829C82YBMR1A_HUMANDisease (JPS)  ---CC59Y
4UniProtVAR_015533C124RBMR1A_HUMANDisease (JPS)199476087CC101R
5UniProtVAR_022830C130RBMR1A_HUMANDisease (JPS)  ---CC107R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041398F58YBMR1A_HUMANUnclassified  ---DF35Y
2UniProtVAR_022828Y62DBMR1A_HUMANDisease (JPS)  ---DY39D
3UniProtVAR_022829C82YBMR1A_HUMANDisease (JPS)  ---DC59Y
4UniProtVAR_015533C124RBMR1A_HUMANDisease (JPS)199476087DC101R
5UniProtVAR_022830C130RBMR1A_HUMANDisease (JPS)  ---DC107R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3NH7)

(-) Exons   (3, 12)

Asymmetric Unit (3, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003720371bENSE00001456788chr10:88516407-88516676270BMR1A_HUMAN-00--
1.2aENST000003720372aENSE00001456787chr10:88598622-88598736115BMR1A_HUMAN-00--
1.4aENST000003720374aENSE00001456785chr10:88635616-88635842227BMR1A_HUMAN1-23230--
1.5cENST000003720375cENSE00000711713chr10:88649819-88649981163BMR1A_HUMAN23-77554A:34-54
B:34-54
C:34-54
D:34-54
21
21
21
21
1.6ENST000003720376ENSE00000711717chr10:88651884-88651986103BMR1A_HUMAN77-111354A:54-88
B:54-88
C:54-88
D:54-88
35
35
35
35
1.7ENST000003720377ENSE00000711722chr10:88659551-8865964797BMR1A_HUMAN112-144334A:89-118
B:89-118
C:89-118
D:89-118
30
30
30
30
1.8ENST000003720378ENSE00000711728chr10:88659784-88659883100BMR1A_HUMAN144-177340--
1.9ENST000003720379ENSE00000711732chr10:88671997-88672141145BMR1A_HUMAN177-225490--
1.10aENST0000037203710aENSE00000711737chr10:88676891-88677083193BMR1A_HUMAN226-290650--
1.11bENST0000037203711bENSE00000711742chr10:88678929-88679226298BMR1A_HUMAN290-3891000--
1.12ENST0000037203712ENSE00001646386chr10:88681277-88681452176BMR1A_HUMAN389-448600--
1.13ENST0000037203713ENSE00000830582chr10:88683133-88683263131BMR1A_HUMAN448-491440--
1.14bENST0000037203714bENSE00001456760chr10:88683351-886849451595BMR1A_HUMAN492-532410--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:85
 aligned with BMR1A_HUMAN | P36894 from UniProtKB/Swiss-Prot  Length:532

    Alignment length:85
                                    66        76        86        96       106       116       126       136     
          BMR1A_HUMAN    57 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 141
               SCOP domains d3nh7a_ A: BMP receptor Ia ectodomain                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..............eee..eeeeeeee.....eeeeeeee..................eeeeee................ Sec.struct. author
                 SAPs(SNPs) -Y---D-------------------Y-----------------------------------------R-----R----------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5c            ----------------------------------Exon 1.7  PDB: A:89-118        Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.6  PDB: A:54-88             ------------------------------ Transcript 1 (2)
                 3nh7 A  34 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 118
                                    43        53        63        73        83        93       103       113     

Chain B from PDB  Type:PROTEIN  Length:85
 aligned with BMR1A_HUMAN | P36894 from UniProtKB/Swiss-Prot  Length:532

    Alignment length:85
                                    66        76        86        96       106       116       126       136     
          BMR1A_HUMAN    57 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 141
               SCOP domains d3nh7b_ B: BMP receptor Ia ectodomain                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..............eee..eeeeeeee.....eeeeeeee..................eeeeee................ Sec.struct. author
                 SAPs(SNPs) -Y---D-------------------Y-----------------------------------------R-----R----------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5c            ----------------------------------Exon 1.7  PDB: B:89-118        Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.6  PDB: B:54-88             ------------------------------ Transcript 1 (2)
                 3nh7 B  34 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 118
                                    43        53        63        73        83        93       103       113     

Chain C from PDB  Type:PROTEIN  Length:85
 aligned with BMR1A_HUMAN | P36894 from UniProtKB/Swiss-Prot  Length:532

    Alignment length:85
                                    66        76        86        96       106       116       126       136     
          BMR1A_HUMAN    57 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 141
               SCOP domains d3nh7c_ C: BMP receptor Ia ectodomain                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..............eee..eeeeeeee.....eeeeeeee..................eeeeee................ Sec.struct. author
                 SAPs(SNPs) -Y---D-------------------Y-----------------------------------------R-----R----------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5c            ----------------------------------Exon 1.7  PDB: C:89-118        Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.6  PDB: C:54-88             ------------------------------ Transcript 1 (2)
                 3nh7 C  34 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 118
                                    43        53        63        73        83        93       103       113     

Chain D from PDB  Type:PROTEIN  Length:85
 aligned with BMR1A_HUMAN | P36894 from UniProtKB/Swiss-Prot  Length:532

    Alignment length:85
                                    66        76        86        96       106       116       126       136     
          BMR1A_HUMAN    57 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 141
               SCOP domains d3nh7d_ D: BMP receptor Ia ectodomain                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --Activin_recp-3nh7D01 D:36-115                                                   --- Pfam domains (1)
           Pfam domains (2) --Activin_recp-3nh7D02 D:36-115                                                   --- Pfam domains (2)
           Pfam domains (3) --Activin_recp-3nh7D03 D:36-115                                                   --- Pfam domains (3)
           Pfam domains (4) --Activin_recp-3nh7D04 D:36-115                                                   --- Pfam domains (4)
         Sec.struct. author ..eee..............eee..eeeeeeee.....eeeeeeee..................eeeeee................ Sec.struct. author
                 SAPs(SNPs) -Y---D-------------------Y-----------------------------------------R-----R----------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5c            ----------------------------------Exon 1.7  PDB: D:89-118        Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.6  PDB: D:54-88             ------------------------------ Transcript 1 (2)
                 3nh7 D  34 PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV 118
                                    43        53        63        73        83        93       103       113     

Chain H from PDB  Type:PROTEIN  Length:207
                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.......eeeeee....eeeeee...hhhhheeeeeeeeee...eeeeee...eeeee........eeeee.....eeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeee....eeeeeeehhhheeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3nh7 H   1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSNYTLNWVRQAPGKGLEWVSYTSSSGSLTGYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARERWHVRGYFDHWGQGTLVTVSSASTKGPSVFPLAPSSAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSTYICNVNHKPSNTKVDKKVEP 220
                                    10        20        30        40        50        60        70        80        90       100       110       120       130    || 147       157       167       177       187     ||203       213       
                                                                                                                                                                135|                                               193|                    
                                                                                                                                                                 143                                                200                    

Chain I from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee..hhhhh.eeeeee......eeeeee......eee.......eeeeee....eeeeee...hhhhheeeeeeeeee...eeeeee...eeeee........eeeee.....eeeeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeeeee.hhh.....eeeeeehhhheeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3nh7 I   1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSNYTLNWVRQAPGKGLEWVSYTSSSGSLTGYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARERWHVRGYFDHWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP 220
                                    10        20        30        40        50        60        70        80        90       100       110       120       130    || 145       155       165       175       185       195       205       215     
                                                                                                                                                                135|                                                                               
                                                                                                                                                                 141                                                                               

Chain J from PDB  Type:PROTEIN  Length:221
                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee..hhhhh.eeeeee......eeeeee......eee.......eeeeee....eeeeee...hhhhheeeeeeeeee...eeeeee...eeeee........eeeee..........eeeeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeeeee.........eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3nh7 J   1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSNYTLNWVRQAPGKGLEWVSYTSSSGSLTGYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARERWHVRGYFDHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK 221
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220 

Chain K from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee..hhhhh.eeeeee......eeeeee......eee.......eeeeee....eeeeee...hhhhheeeeeeeeee...eeeeee...eeeee........eeeee.....eeeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeeee..........eeeeeehhhheeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3nh7 K   1 QVQLVESGGGLVQPGGSLRLSCAASGFTFSNYTLNWVRQAPGKGLEWVSYTSSSGSLTGYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARERWHVRGYFDHWGQGTLVTVSSASTKGPSVFPLAPSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK 221
                                    10        20        30        40        50        60        70        80        90       100       110       120       130    || 146       156       166       176       186       196       206       216     
                                                                                                                                                                135|                                                                               
                                                                                                                                                                 142                                                                               

Chain L from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d3nh7l1 L:2-109 automated matches                                                                           d3nh7l2 L:110-211 automated matches                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee.....eeeeee..hhhhh..eeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeeee......eee...eeeee........eeeee..hhhhhhh..eeeeeeeeee.....eeeeee..ee....eee...ee.....eeeeeeeeehhhhhhhh..eeeeeee..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3nh7 L   2 IELTQPPSVSVAPGQTARISCSGDSLGSKYVIWYQQKPGQAPVLVIYDDSNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSTFTMSGNGTVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT 211
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Chain M from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d3nh7m1 M:2-109 automated matches                                                                           d3nh7m2 M:110-211 automated matches                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee.....eeeeee..hhhhh.eeeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeeee......eee...eeeee........eeeee..hhhhhh...eeeeeeeeee.....eeeeee..ee....eee...ee.....eeeeeeeeehhhhhhhh..eeeeeee..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3nh7 M   2 IELTQPPSVSVAPGQTARISCSGDSLGSKYVIWYQQKPGQAPVLVIYDDSNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSTFTMSGNGTVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT 211
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Chain N from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d3nh7n1 N:2-109 automated matches                                                                           d3nh7n2 N:110-211 automated matches                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee.....eeeeee..hhhhh..eeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeeee......eee...eeeee........eeeee..hhhhhhh..eeeeeeeeee.....eeeeee..ee....eee...ee.....eeeeeeeeehhhhhhhh..eeeeeee..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3nh7 N   2 IELTQPPSVSVAPGQTARISCSGDSLGSKYVIWYQQKPGQAPVLVIYDDSNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSTFTMSGNGTVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT 211
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

Chain O from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains d3nh7o1 O:2-109 automated matches                                                                           d3nh7o2 O:110-211 automated matches                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee.....eeeeee..hhhhh..eeeee......eeee.............eeeeee..eeeeee...hhhhheeeeeeee......eee...eeeee........eeeee..hhhhhhh..eeeeeeeeee.....eeeeee..ee....eee...ee.....eeeeeeeeehhhhhhhh..eeeeeee..eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3nh7 O   2 IELTQPPSVSVAPGQTARISCSGDSLGSKYVIWYQQKPGQAPVLVIYDDSNRPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSTFTMSGNGTVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT 211
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 12)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NH7)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (76, 76)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (BMR1A_HUMAN | P36894)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0098821    BMP receptor activity    Combining with a member of the bone morphogenetic protein (BMP) family, and transmitting a signal across the plasma membrane to initiate a change in cell activity.
    GO:0000981    RNA polymerase II transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription by RNA polymerase II. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0046332    SMAD binding    Interacting selectively and non-covalently with a SMAD signaling protein.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004702    signal transducer, downstream of receptor, with serine/threonine kinase activity    Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004675    transmembrane receptor protein serine/threonine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
biological process
    GO:0030509    BMP signaling pathway    A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0001880    Mullerian duct regression    The process in which the Mullerian ducts, primordia of the oviducts, uterus and upper vagina, undergo regression in male embryos.
    GO:0009952    anterior/posterior pattern specification    The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
    GO:0051216    cartilage development    The process whose specific outcome is the progression of a cartilage element over time, from its formation to the mature structure. Cartilage elements are skeletal elements that consist of connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0071773    cellular response to BMP stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
    GO:0002062    chondrocyte differentiation    The process in which a chondroblast acquires specialized structural and/or functional features of a chondrocyte. A chondrocyte is a polymorphic cell that forms cartilage.
    GO:0048589    developmental growth    The increase in size or mass of an entire organism, a part of an organism or a cell, where the increase in size or mass has the specific outcome of the progression of the organism over time from one condition to another.
    GO:0009950    dorsal/ventral axis specification    The establishment, maintenance and elaboration of the dorsal/ventral axis. The dorsal/ventral axis is defined by a line that runs orthogonal to both the anterior/posterior and left/right axes. The dorsal end is defined by the upper or back side of an organism. The ventral end is defined by the lower or front side of an organism.
    GO:0009953    dorsal/ventral pattern formation    The regionalization process in which the areas along the dorsal/ventral axis are established that will lead to differences in cell differentiation. The dorsal/ventral axis is defined by a line that runs orthogonal to both the anterior/posterior and left/right axes. The dorsal end is defined by the upper or back side of an organism. The ventral end is defined by the lower or front side of an organism.
    GO:0007398    ectoderm development    The process whose specific outcome is the progression of the ectoderm over time, from its formation to the mature structure. In animal embryos, the ectoderm is the outer germ layer of the embryo, formed during gastrulation.
    GO:0042733    embryonic digit morphogenesis    The process, occurring in the embryo, by which the anatomical structures of the digit are generated and organized. A digit is one of the terminal divisions of an appendage, such as a finger or toe.
    GO:0048598    embryonic morphogenesis    The process in which anatomical structures are generated and organized during the embryonic phase. The embryonic phase begins with zygote formation. The end of the embryonic phase is organism-specific. For example, it would be at birth for mammals, larval hatching for insects and seed dormancy in plants.
    GO:0048568    embryonic organ development    Development, taking place during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Development pertains to the process whose specific outcome is the progression of a structure over time, from its formation to the mature structure. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0003272    endocardial cushion formation    The developmental process pertaining to the initial formation of an endocardial cushion. The endocardial cushion is a specialized region of mesenchymal cells that will give rise to the heart septa and valves.
    GO:0007492    endoderm development    The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0060914    heart formation    The developmental process pertaining to the initial formation of the heart from unspecified parts. This process begins with the specific processes that contribute to the appearance of the heart field and the arrival of cardiac neural crest to the heart region. The process ends when the structural rudiment is recognizable.
    GO:0003007    heart morphogenesis    The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0035137    hindlimb morphogenesis    The process in which the anatomical structures of the hindlimb are generated and organized.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0048368    lateral mesoderm development    The process whose specific outcome is the progression of the lateral mesoderm over time, from its formation to the mature structure.
    GO:0030324    lung development    The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
    GO:0048382    mesendoderm development    The process whose specific outcome is the progression of the mesendoderm over time, from its formation to the mature structure. In animal embryos, mesendoderm development gives rise to both mesoderm and endoderm tissues.
    GO:0001707    mesoderm formation    The process that gives rise to the mesoderm. This process pertains to the initial formation of the structure from unspecified parts.
    GO:0050768    negative regulation of neurogenesis    Any process that stops, prevents, or reduces the frequency, rate or extent of neurogenesis, the origin and formation of neurons.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0014032    neural crest cell development    The process aimed at the progression of a neural crest cell over time, from initial commitment of the cell to its specific fate, to the fully functional differentiated cell.
    GO:0021998    neural plate mediolateral regionalization    The process that regulates the coordinated growth and differentiation that establishes the non-random mediolateral spatial arrangement of the neural plate.
    GO:0060896    neural plate pattern specification    The developmental process that results in the creation of defined areas or spaces within the neural plate to which cells respond and eventually are instructed to differentiate.
    GO:0042475    odontogenesis of dentin-containing tooth    The process whose specific outcome is the progression of a dentin-containing tooth over time, from its formation to the mature structure. A dentin-containing tooth is a hard, bony organ borne on the jaw or other bone of a vertebrate, and is composed mainly of dentin, a dense calcified substance, covered by a layer of enamel.
    GO:0060021    palate development    The biological process whose specific outcome is the progression of the palate from an initial condition to its mature state. This process begins with the formation of the structure and ends with the mature structure. The palate is the partition that separates the nasal and oral cavities.
    GO:0048339    paraxial mesoderm development    The process whose specific outcome is the progression of the paraxial mesoderm over time, from its formation to the mature structure. The paraxial mesoderm is the mesoderm located bilaterally adjacent to the notochord and neural tube.
    GO:0048352    paraxial mesoderm structural organization    The process that contributes to the act of creating the structural organization of the paraxial mesoderm. This process pertains to the physical shaping of a rudimentary structure.
    GO:0007389    pattern specification process    Any developmental process that results in the creation of defined areas or spaces within an organism to which cells respond and eventually are instructed to differentiate.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0021983    pituitary gland development    The progression of the pituitary gland over time from its initial formation until its mature state. The pituitary gland is an endocrine gland that secretes hormones that regulate many other glands.
    GO:0060391    positive regulation of SMAD protein import into nucleus    Any process that increases the rate, frequency or extent of SMAD protein import into the nucleus, i.e. the directed movement of a SMAD proteins from the cytoplasm into the nucleus. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0030501    positive regulation of bone mineralization    Any process that activates or increases the frequency, rate or extent of bone mineralization.
    GO:0050679    positive regulation of epithelial cell proliferation    Any process that activates or increases the rate or extent of epithelial cell proliferation.
    GO:0002053    positive regulation of mesenchymal cell proliferation    The process of activating or increasing the rate or extent of mesenchymal cell proliferation. Mesenchymal cells are loosely organized embryonic cells.
    GO:0045669    positive regulation of osteoblast differentiation    Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
    GO:0010862    positive regulation of pathway-restricted SMAD protein phosphorylation    Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:2000772    regulation of cellular senescence    Any process that modulates the frequency, rate or extent of cellular senescence.
    GO:0048378    regulation of lateral mesodermal cell fate specification    Any process that modulates the frequency, rate or extent of lateral mesoderm cell fate specification.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
    GO:0001756    somitogenesis    The formation of mesodermal clusters that are arranged segmentally along the anterior posterior axis of an embryo.
    GO:0019827    stem cell population maintenance    The process by which an organism or tissue maintains a population of stem cells of a single type. This can be achieved by a number of mechanisms: stem cell asymmetric division maintains stem cell numbers; stem cell symmetric division increases them; maintenance of a stem cell niche maintains the conditions for commitment to the stem cell fate for some types of stem cell; stem cells may arise de novo from other cell types.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007178    transmembrane receptor protein serine/threonine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses serine/threonine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:1990712    HFE-transferrin receptor complex    A protein complex containing at least HFE and a transferrin receptor (either TFR1/TFRC or TFR2), proposed to play a role in the sensing of transferrin-bound Fe (Fe2-Tf) on the plasma membrane to regulate hepcidin transcription.
    GO:0005901    caveola    A membrane raft that forms small pit, depression, or invagination that communicates with the outside of a cell and extends inward, indenting the cytoplasm and the cell membrane. Examples include flask-shaped invaginations of the plasma membrane in adipocytes associated with caveolin proteins, and minute pits or incuppings of the cell membrane formed during pinocytosis. Caveolae may be pinched off to form free vesicles within the cytoplasm.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3nh7)
 
  Sites
(no "Sites" information available for 3nh7)
 
  Cis Peptide Bonds
    Glu H:155 - Pro H:156   [ RasMol ]  
    Glu I:155 - Pro I:156   [ RasMol ]  
    Glu J:155 - Pro J:156   [ RasMol ]  
    Glu K:155 - Pro K:156   [ RasMol ]  
    Phe H:153 - Pro H:154   [ RasMol ]  
    Phe I:153 - Pro I:154   [ RasMol ]  
    Phe J:153 - Pro J:154   [ RasMol ]  
    Phe K:153 - Pro K:154   [ RasMol ]  
    Tyr L:142 - Pro L:143   [ RasMol ]  
    Tyr M:142 - Pro M:143   [ RasMol ]  
    Tyr N:142 - Pro N:143   [ RasMol ]  
    Tyr O:142 - Pro O:143   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3nh7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BMR1A_HUMAN | P36894
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.30
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  174900
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BMR1A_HUMAN | P36894
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BMR1A_HUMAN | P368941es7 1rew 2goo 2h62 2h64 2k3g 2qj9 2qja 2qjb 3qb4

(-) Related Entries Specified in the PDB File

1rew COMPLEX OF THE BMP TYPE I RECEPTOR BMPR-IA BOUND TO ITS LIGAND BMP-2
2k3g NMR STRUCTURE OF THE FREE BMP TYPE I RECEPTOR BMPR-IA