|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3ORC) |
Sites (0, 0)| (no "Site" information available for 3ORC) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3ORC) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ORC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ORC) |
Exons (0, 0)| (no "Exon" information available for 3ORC) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:65 aligned with RCRO_LAMBD | P03040 from UniProtKB/Swiss-Prot Length:66 Alignment length:65 56 57 11 21 31 41 51 | -| RCRO_LAMBD 2 EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVK-----PFPSN 61 SCOP domains d3orca_ A: cro lambda repressor SCOP domains CATH domains 3orcA00 A:2-66 CRO Repressor CATH domains Pfam domains Cro-3orcA01 A:2-56 ---------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 3orc A 2 EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN 66 11 21 31 41 51 61
Chain R from PDB Type:DNA Length:8
3orc R 1 TATCGATA 8
Chain S from PDB Type:DNA Length:8
3orc S 1 TATCGATA 8
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RCRO_LAMBD | P03040)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|