|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1D1M) |
Sites (0, 0)| (no "Site" information available for 1D1M) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1D1M) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1D1M) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1D1M) |
Exons (0, 0)| (no "Exon" information available for 1D1M) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:65 aligned with RCRO_LAMBD | P03040 from UniProtKB/Swiss-Prot Length:66 Alignment length:65 10 20 30 40 50 60 RCRO_LAMBD 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTT 65 SCOP domains d1d1ma_ A: cro lambda repressor SCOP domains CATH domains 1d1mA00 A:1-65 CRO Repressor CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 1d1m A 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS 65 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:65 aligned with RCRO_LAMBD | P03040 from UniProtKB/Swiss-Prot Length:66 Alignment length:65 10 20 30 40 50 60 RCRO_LAMBD 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTT 65 SCOP domains d1d1mb_ B: cro lambda repressor SCOP domains CATH domains 1d1mB00 B:1-65 CRO Repressor CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 1d1m B 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS 65 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1D1M) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (RCRO_LAMBD | P03040)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|