|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1COP) |
(no "Site" information available for 1COP) |
(no "SS Bond" information available for 1COP) |
NMR Structure
|
(no "SAP(SNP)/Variant" information available for 1COP) |
(no "PROSITE Motif" information available for 1COP) |
(no "Exon" information available for 1COP) |
NMR StructureChain D from PDB Type:PROTEIN Length:66 aligned with RCRO_LAMBD | P03040 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 RCRO_LAMBD 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA 66 SCOP domains d1copd_ D: cro lambda repressor SCOP domains CATH domains 1copD00 D:1-66 CRO Repressor CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 1cop D 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA 66 10 20 30 40 50 60 Chain E from PDB Type:PROTEIN Length:66 aligned with RCRO_LAMBD | P03040 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 RCRO_LAMBD 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA 66 SCOP domains d1cope_ E: cro lambda repressor SCOP domains CATH domains 1copE00 E:1-66 CRO Repressor CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------ Transcript 1cop E 1 MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA 66 10 20 30 40 50 60
|
NMR Structure
|
NMR Structure |
(no "Pfam Domain" information available for 1COP) |
NMR Structure(hide GO term definitions) Chain D,E (RCRO_LAMBD | P03040)
|
|
|
|
|
|
|