|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (1, 3) Biological Unit 2 (1, 1) Biological Unit 3 (0, 0) Biological Unit 4 (1, 1) Biological Unit 5 (0, 0) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3NJN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3NJN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3NJN) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3NJN) |
Exons (0, 0)| (no "Exon" information available for 3NJN) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:114 aligned with Q8EGA7_SHEON | Q8EGA7 from UniProtKB/TrEMBL Length:125 Alignment length:114 12 22 32 42 52 62 72 82 92 102 112 Q8EGA7_SHEON 3 APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD 116 SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 3njn A 3 APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD 116 12 22 32 42 52 62 72 82 92 102 112 Chain B from PDB Type:PROTEIN Length:8 aligned with Q8EGA7_SHEON | Q8EGA7 from UniProtKB/TrEMBL Length:125 Alignment length:8 Q8EGA7_SHEON 117 PQIINRPQ 124 SCOP domains -------- SCOP domains CATH domains -------- CATH domains Pfam domains -------- Pfam domains SAPs(SNPs) -------- SAPs(SNPs) PROSITE -------- PROSITE Transcript -------- Transcript 3njn B 117 PAIINRPQ 124 Chain C from PDB Type:PROTEIN Length:114 aligned with Q8EGA7_SHEON | Q8EGA7 from UniProtKB/TrEMBL Length:125 Alignment length:114 12 22 32 42 52 62 72 82 92 102 112 Q8EGA7_SHEON 3 APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD 116 SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 3njn C 3 APQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPD 116 12 22 32 42 52 62 72 82 92 102 112 Chain D from PDB Type:PROTEIN Length:7 aligned with Q8EGA7_SHEON | Q8EGA7 from UniProtKB/TrEMBL Length:125 Alignment length:7 Q8EGA7_SHEON 117 PQIINRP 123 SCOP domains ------- SCOP domains CATH domains ------- CATH domains Pfam domains (1) --DUF18 Pfam domains (1) Pfam domains (2) --DUF18 Pfam domains (2) Pfam domains (3) --DUF18 Pfam domains (3) Pfam domains (4) --DUF18 Pfam domains (4) SAPs(SNPs) ------- SAPs(SNPs) PROSITE ------- PROSITE Transcript ------- Transcript 3njn D 117 PAIINRP 123
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3NJN) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3NJN) |
Pfam Domains (1, 4)
Asymmetric Unit
|
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (Q8EGA7_SHEON | Q8EGA7)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|