|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3NJL) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3NJL) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3NJL) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3NJL) |
Exons (0, 0)| (no "Exon" information available for 3NJL) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:119 aligned with Q8EGA7_SHEON | Q8EGA7 from UniProtKB/TrEMBL Length:125 Alignment length:119 14 24 34 44 54 64 74 84 94 104 114 Q8EGA7_SHEON 5 QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDPQIINRP 123 SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains DUF1888-3njlA01 A:5-123 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 3njl A 5 QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRP 123 14 24 34 44 54 64 74 84 94 104 114
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3NJL) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3NJL) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (Q8EGA7_SHEON | Q8EGA7)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|