|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3NJI) |
Sites (0, 0)| (no "Site" information available for 3NJI) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3NJI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3NJI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3NJI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3NJI) |
Exons (0, 0)| (no "Exon" information available for 3NJI) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:119 aligned with Q8EGA7_SHEON | Q8EGA7 from UniProtKB/TrEMBL Length:125 Alignment length:119 14 24 34 44 54 64 74 84 94 104 114 Q8EGA7_SHEON 5 QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDPQIINRP 123 SCOP domains ----------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 3nji A 5 QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLAPDPQIINRP 123 14 24 34 44 54 64 74 84 94 104 114 Chain B from PDB Type:PROTEIN Length:7 aligned with Q8EGA7_SHEON | Q8EGA7 from UniProtKB/TrEMBL Length:125 Alignment length:7 Q8EGA7_SHEON 117 PQIINRP 123 SCOP domains ------- SCOP domains CATH domains ------- CATH domains Pfam domains (1) DUF1888 Pfam domains (1) Pfam domains (2) DUF1888 Pfam domains (2) SAPs(SNPs) ------- SAPs(SNPs) PROSITE ------- PROSITE Transcript ------- Transcript 3nji B 117 PQIINRP 123
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3NJI) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3NJI) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q8EGA7_SHEON | Q8EGA7)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|