3LTF - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:522
 aligned with EGFR_DROME | P04412 from UniProtKB/Swiss-Prot  Length:1426

    Alignment length:535
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626     
           EGFR_DROME    97 VKGKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYVDGNLKLTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEAVSKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERREVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCN 631
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee..........hhhhhhhhhhhhhh...eee..eeeeee......hhhhhh..ee...eeeeee...eee.....ee.........--...eeeeee.....eee.....ee...eeeee......hhhhh.............------....................hhhhh........hhhhh................eeeee.......eeee..eee..eee......eeee....eeee.....eee..eee.......eee..eee......eeee..eeee.......eee.....hhhhhhhhh...eee..eeehhhhhhh.eee.....eeee....hhhhhhhhhhh.ee...eee.........hhhhh...eee.........eeeeee.............eee..eeeee.....hhhhh.hhhhh.......eeee...hhhhhhhhh.........................eee..eee........ee.....eeee..-----.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ltf A  -2 HHHKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLS--EEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTIQWSEIVSNGTDAY------APERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADCGYISNAYKFDNRTCKICH-----CN 532
                                     7        17        27        37        47        57        67        77        87 |  |   97       107       117       127       137       147      |157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       | -   | 
                                                                                                                      89 92                                                    147    154                                                                                                                                                                                                                                                                                                                                                                                525   531

Chain B from PDB  Type:PROTEIN  Length:57
 aligned with SPITZ_DROME | Q01083 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:57
                                    86        96       106       116       126       
          SPITZ_DROME    77 FPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPK 133
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhh.....eeeeee....eeeeee....ee.....ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -EGF_3  PDB: B:3-47 UniProt: 78-122           ----------- PROSITE (1)
                PROSITE (2) ---------------------------------EGF_1       ------------ PROSITE (2)
                PROSITE (3) ---------------------------------EGF_2       ------------ PROSITE (3)
                 Transcript --------------------------------------------------------- Transcript
                 3ltf B   2 FPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPK  58
                                    11        21        31        41        51

Chain C from PDB  Type:PROTEIN  Length:531
 aligned with EGFR_DROME | P04412 from UniProtKB/Swiss-Prot  Length:1426

    Alignment length:540
                                   108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638
           EGFR_DROME    99 GKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYVDGNLKLTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTIQWSEIVSNGTDAYYNYDFTAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEAVSKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERREVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLTCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNGAGADHC 638
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------------------------------------------------------------------------Furin-like-3ltfC01 C:153-305                                                                                                                             --------------Recep_L_domain-3ltfC03 C:320-449                                                                                                  ------------------------------------------------------------------------------------------ Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------Furin-like-3ltfC02 C:153-305                                                                                                                             --------------Recep_L_domain-3ltfC04 C:320-449                                                                                                  ------------------------------------------------------------------------------------------ Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Recep_L_domain-3ltfC05 C:320-449                                                                                                  ------------------------------------------------------------------------------------------ Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Recep_L_domain-3ltfC06 C:320-449                                                                                                  ------------------------------------------------------------------------------------------ Pfam domains (4)
         Sec.struct. author ..eee.......ee.hhhhhhhhhhhhhh...eee..eeeeee......hhhhh...ee...eeeeee...eee.....ee..............eeeeee.....eee.....ee...eeeee....................---------..................................hhhhh................eeeee.......eeee..eee..eee......eeee....eeee.....eee..eee.......eee..eee......eeee..eeee..................hhhhhh...ee...eeehhhhhhheeee.....eeeee...hhhhhhhhhhh.ee...eee.........hhhhh...ee..........eeeeee.............ee...eeeee...........hhhhh.......eeee...hhhhhhhhh.........................eee..eee........eeeee..eeee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3ltf C   0 HKICIGTKSRLSVPSNKEHHYRNLRDRYTNCTYVDGNLELTWLPNENLDLSFLDNIREVTGYILISHVDVKKVVFPKLQIIRGRTLFSLSVEEEKYALFVTYSKMYTLEIPDLRDVLNGQVGFHNNYNLCHMRTIQWSEIVSNG---------TAPERECPKCHESCTHGCWGEGPKNCQKFSKLTCSPQCAGGRCYGPKPRECCHLFCAGGCTGPTQKDCIACKNFFDEGVCKEECPPMRKYNPTTYVLETNPEGKYAYGATCVKECPGHLLRDNGACVRSCPQDKMDKGGECVPCNGPCPKTCPGVTVLHAGNIDSFRNCTVIDGNIRILDQTFSGFQDVYANYTMGPRYIPLDPERLEVFSTVKEITGYLNIEGTHPQFRNLSYFRNLETIHGRQLMESMFAALAIVKSSLYSLEMRNLKQISSGSVVIQHNRDLCYVSNIRWPAIQKEPEQKVWVNENLRADLCEKNGTICSDQCNEDGCWGAGTDQCLNCKNFNFNGTCIADCGYISNAYKFDNRTCKICHPECRTCNGAGADHC 539
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139   |     -   |   159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539
                                                                                                                                                                         143       153

Chain D from PDB  Type:PROTEIN  Length:57
 aligned with SPITZ_DROME | Q01083 from UniProtKB/Swiss-Prot  Length:234

    Alignment length:57
                                    86        96       106       116       126       
          SPITZ_DROME    77 FPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPK 133
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
           Pfam domains (1) -----EGF-3ltfD01 D:7-45                     ------------- Pfam domains (1)
           Pfam domains (2) -----EGF-3ltfD02 D:7-45                     ------------- Pfam domains (2)
         Sec.struct. author ......hhhhhhhh.....eeeeeee..eeeeeeee...ee.....ee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -EGF_3  PDB: D:3-47 UniProt: 78-122           ----------- PROSITE (1)
                PROSITE (2) ---------------------------------EGF_1       ------------ PROSITE (2)
                PROSITE (3) ---------------------------------EGF_2       ------------ PROSITE (3)
                 Transcript --------------------------------------------------------- Transcript
                 3ltf D   2 FPTYKCPETFDAWYCLNDAHCFAVKIADLPVYSCECAIGFMGQRCEYKEIDNTYLPK  58
                                    11        21        31        41        51

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,C (EGFR_DROME | P04412)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0005006	epidermal growth factor-activated receptor activity	Combining with an epidermal growth factor and transmitting the signal across the plasma membrane to initiate a change in cell activity.
	GO:0008313	gurken-activated receptor activity	Combining with the ligand Gurken to initiate a change in cell activity.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0004714	transmembrane receptor protein tyrosine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
	GO:0004888	transmembrane signaling receptor activity	Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
	GO:0000086	G2/M transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
	GO:0007443	Malpighian tubule morphogenesis	The process in which the anatomical structures of the Malpighian tubule are generated and organized. This process takes place entirely during the embryonic phase. A Malpighian tubule is a fine, thin-walled excretory tubule in insects which leads into the posterior part of the gut.
	GO:0045466	R7 cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of the R7 photoreceptor.
	GO:0007469	antennal development	The process whose specific outcome is the progression of the antenna over time, from its formation to the mature structure. The antenna are the sensory structures on the head that are capable of detecting various environmental stimuli.
	GO:0009952	anterior/posterior pattern specification	The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
	GO:0048149	behavioral response to ethanol	Any process that results in a change in the behavior of an organism as a result of an ethanol stimulus.
	GO:0007350	blastoderm segmentation	The hierarchical steps resulting in the progressive subdivision of the anterior/posterior axis of the embryo.
	GO:0007298	border follicle cell migration	The directed movement of a border cell through the nurse cells to reach the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0007420	brain development	The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
	GO:0046845	branched duct epithelial cell fate determination, open tracheal system	Allocation of a set number of cells to each primary branch in an open tracheal system, prior to the onset of cell migration. This establishes different domains of cells within the tracheal placode.
	GO:0045165	cell fate commitment	The commitment of cells to specific cell fates and their capacity to differentiate into particular kinds of cells. Positional information is established through protein signals that emanate from a localized source within a cell (the initial one-cell zygote) or within a developmental field.
	GO:0001709	cell fate determination	A process involved in cell fate commitment. Once determination has taken place, a cell becomes committed to differentiate down a particular pathway regardless of its environment.
	GO:0030031	cell projection assembly	Formation of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0030381	chorion-containing eggshell pattern formation	The regionalization process that gives rise to the structural pattern of a chorion-containing eggshell such as those found in insects.
	GO:0042676	compound eye cone cell fate commitment	The process in which the cone cells of the compound eye, the lens-secreting cells in the ommatidia, adopt pathways of differentiation that lead to the establishment of their distinct cell type.
	GO:0048749	compound eye development	The process whose specific outcome is the progression of the compound eye over time, from its formation to the mature structure. The compound eye is an organ of sight that contains multiple repeating units, often arranged hexagonally. Each unit has its own lens and photoreceptor cell(s) and can generate either a single pixelated image or multiple images, per eye.
	GO:0001745	compound eye morphogenesis	The morphogenetic process in which the anatomical structures of the compound eye are generated and organized. The adult compound eye is a precise assembly of 700-800 ommatidia. Each ommatidium is composed of 20 cells, identified by cell type and position. An example of compound eye morphogenesis is found in Drosophila melanogaster.
	GO:0001751	compound eye photoreceptor cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an eye photoreceptor cell.
	GO:0001752	compound eye photoreceptor fate commitment	The process in which the developmental fate of a cell becomes restricted such that it will develop into a compound eye photoreceptor cell. A photoreceptor cell is a cell that responds to incident electromagnetic radiation. Different classes of photoreceptor have different spectral sensitivities and express different photosensitive pigments.
	GO:0008340	determination of adult lifespan	The control of viability and duration in the adult phase of the life-cycle.
	GO:0035225	determination of genital disc primordium	Allocation of embryonic cells to the genital imaginal disc founder populations. Early in development at the blastoderm stage, the anlage of the genital disc of both sexes consists of three primordia: the female genital primoridum lcoated anteriorly, the anal primoridum located posteriorly, and the male gential primordium between the two.
	GO:0048546	digestive tract morphogenesis	The process in which the anatomical structures of the digestive tract are generated and organized. The digestive tract is the anatomical structure through which food passes and is processed.
	GO:0046843	dorsal appendage formation	Establishment of the dorsal filaments, elaborate specializations of the chorion that protrude from the anterior end of the egg and facilitate embryonic respiration.
	GO:0007391	dorsal closure	The process during Drosophila embryogenesis whereby the ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally.
	GO:0009950	dorsal/ventral axis specification	The establishment, maintenance and elaboration of the dorsal/ventral axis. The dorsal/ventral axis is defined by a line that runs orthogonal to both the anterior/posterior and left/right axes. The dorsal end is defined by the upper or back side of an organism. The ventral end is defined by the lower or front side of an organism.
	GO:0009953	dorsal/ventral pattern formation	The regionalization process in which the areas along the dorsal/ventral axis are established that will lead to differences in cell differentiation. The dorsal/ventral axis is defined by a line that runs orthogonal to both the anterior/posterior and left/right axes. The dorsal end is defined by the upper or back side of an organism. The ventral end is defined by the lower or front side of an organism.
	GO:0009792	embryo development ending in birth or egg hatching	The process whose specific outcome is the progression of an embryo over time, from zygote formation until the end of the embryonic life stage. The end of the embryonic life stage is organism-specific and may be somewhat arbitrary; for mammals it is usually considered to be birth, for insects the hatching of the first instar larva from the eggshell.
	GO:0000578	embryonic axis specification	The establishment, maintenance and elaboration of a pattern along a line or a point in an embryo.
	GO:0009880	embryonic pattern specification	The process that results in the patterns of cell differentiation that will arise in an embryo.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0061331	epithelial cell proliferation involved in Malpighian tubule morphogenesis	The multiplication or reproduction of epithelial cells, resulting in the expansion of a cell population and contributing to the shaping of a Malpighian tubule.
	GO:0035088	establishment or maintenance of apical/basal cell polarity	Any cellular process that results in the specification, formation or maintenance polarization of a cell's architecture along its apical/basal axis so that the apical and basal regions of the cell have different membrane, extracellular matrix and sub-membrane cellular components.
	GO:0001654	eye development	The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
	GO:0007455	eye-antennal disc morphogenesis	The process in which the anatomical structures derived from the eye-antennal disc are generated and organized. This includes the transformation of an eye-antennal imaginal disc from a monolayered epithelium in the larvae of holometabolous insects into recognizable adult structures including the eye, antenna, head capsule and maxillary palps.
	GO:0048139	female germ-line cyst encapsulation	Formation of a single follicular epithelium around the germ-line derived cells of a cyst formed in the female gonad.
	GO:0007369	gastrulation	A complex and coordinated series of cellular movements that occurs at the end of cleavage during embryonic development of most animals. The details of gastrulation vary from species to species, but usually result in the formation of the three primary germ layers, ectoderm, mesoderm and endoderm.
	GO:0007390	germ-band shortening	The spreading of the amnioserosa from its compressed state to cover the whole of the dorsal surface. Initiating in the thorax and spreading posteriorly, it is accompanied by the transition from a parasegmental to segmental division of the embryo.
	GO:0030718	germ-line stem cell population maintenance	Any process by which an organism or tissue maintains a population of germ-line stem cells.
	GO:0008406	gonad development	The process whose specific outcome is the progression of the gonad over time, from its formation to the mature structure. The gonad is an animal organ that produces gametes; in some species it also produces hormones.
	GO:0008314	gurken signaling pathway	The series of molecular signals generated as a consequence of an epidermal growth factor receptor binding to the ligand Gurken.
	GO:0007482	haltere development	The process whose specific outcome is the progression of the haltere over time, from its formation to the mature structure. The haltere is the club-shaped 'balancers' found on each side of the metathorax among the true flies (Diptera). They are the much-modified hind wings.
	GO:0003015	heart process	A circulatory system process carried out by the heart. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0007444	imaginal disc development	The process whose specific outcome is the progression of the imaginal disc over time, from its formation to the metamorphosis to form adult structures. Imaginal discs are epithelial infoldings in the larvae of holometabolous insects that develop into adult structures (legs, antennae, wings, etc.).
	GO:0007447	imaginal disc pattern formation	The regionalization process that results in defined areas of the imaginal disc that will undergo specific cell differentaiton. Imaginal discs are epithelial infoldings in the larvae of holometabolous insects that develop into adult appendages (legs, antennae, wings, etc.) during metamorphosis from larval to adult form.
	GO:0007476	imaginal disc-derived wing morphogenesis	The process in which the anatomical structures of the imaginal disc-derived wing are generated and organized. The wing is an appendage modified for flying.
	GO:0008586	imaginal disc-derived wing vein morphogenesis	The process in which anatomical structures of the veins on an imaginal disc-derived wing are generated and organized.
	GO:0007474	imaginal disc-derived wing vein specification	The regionalization process in which the area of a imaginal disc-derived wing that will form a wing vein is specified.
	GO:0007479	leg disc proximal/distal pattern formation	The establishment, maintenance and elaboration of the proximal/distal axis of the leg imaginal disc, a precursor to the adult leg.
	GO:0035160	maintenance of epithelial integrity, open tracheal system	Ensuring that tracheal tubes in an open tracheal system maintain their epithelial structure during the cell shape changes and movements that occur during the branching process.
	GO:0048140	male germ-line cyst encapsulation	Formation of a single follicular epithelium around the germ-line derived cells of a cyst formed in the male gonad.
	GO:0008071	maternal determination of dorsal/ventral axis, ovarian follicular epithelium, soma encoded	Polarization of the ovarian follicle cells along the dorsal-ventral axis by a gene product encoded by somatic cells. An example of this process is found in Drosophila melanogaster.
	GO:0002009	morphogenesis of an epithelium	The process in which the anatomical structures of epithelia are generated and organized. An epithelium consists of closely packed cells arranged in one or more layers, that covers the outer surfaces of the body or lines any internal cavity or tube.
	GO:0016333	morphogenesis of follicular epithelium	The process in which the anatomical structures of a follicular epithelium are generated and organized.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0016203	muscle attachment	The developmental process in which a skeletal muscle attaches to its target (such as bone or body wall).
	GO:0042694	muscle cell fate specification	The process in which a cell becomes capable of differentiating autonomously into a muscle cell in an environment that is neutral with respect to the developmental pathway; upon specification, the cell fate can be reversed.
	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	Any cell cycle regulatory process that prevents the commitment of a cell from G1 to S phase of the mitotic cell cycle.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:2001234	negative regulation of apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of apoptotic signaling pathway.
	GO:0046673	negative regulation of compound eye retinal cell programmed cell death	Any process that stops, prevents, or reduces the frequency, rate or extent of programmed cell death that occurs in the compound eye retina.
	GO:0022008	neurogenesis	Generation of cells within the nervous system.
	GO:0035310	notum cell fate specification	The process in which a cell in the larval wing imaginal disc becomes capable of differentiating autonomously into a notum cell, if left in its normal environment.
	GO:0007477	notum development	The process whose specific outcome is the progression of the dorsal part of the body over time, from its formation to the mature structure.
	GO:0001742	oenocyte differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an oenocyte. Oenocytes are large secretory cells found in clusters underlying the epidermis of larval abdominal segments.
	GO:0008355	olfactory learning	Any process in an organism in which a relatively long-lasting adaptive behavioral change occurs in response to (repeated) exposure to an olfactory cue.
	GO:0016318	ommatidial rotation	The process in which photoreceptors are arranged in ommatidia in the dorsal and ventral fields to be mirror images. The polarity is established in the imaginal discs concurrently with cell fate specification.
	GO:0007314	oocyte anterior/posterior axis specification	Polarization of the oocyte along its anterior-posterior axis. An example of this is found in Drosophila melanogaster.
	GO:0007309	oocyte axis specification	The establishment, maintenance and elaboration of an axis in the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0007310	oocyte dorsal/ventral axis specification	The establishment, maintenance and elaboration of the dorsal/ventral axis of the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0048477	oogenesis	The complete process of formation and maturation of an ovum or female gamete from a primordial female germ cell. Examples of this process are found in Mus musculus and Drosophila melanogaster.
	GO:0007424	open tracheal system development	The process whose specific outcome is the progression of an open tracheal system over time, from its formation to the mature structure. An open tracheal system is a respiratory system, a branched network of epithelial tubes that supplies oxygen to target tissues via spiracles. An example of this is found in Drosophila melanogaster.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0007422	peripheral nervous system development	The process whose specific outcome is the progression of the peripheral nervous system over time, from its formation to the mature structure. The peripheral nervous system is one of the two major divisions of the nervous system. Nerves in the PNS connect the central nervous system (CNS) with sensory organs, other organs, muscles, blood vessels and glands.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0090303	positive regulation of wound healing	Any process that increases the rate, frequency, or extent of the series of events that restore integrity to a damaged tissue, following an injury.
	GO:0007458	progression of morphogenetic furrow involved in compound eye morphogenesis	The morphogenetic furrow is a dorsoventral indentation which sweeps anteriorly across the eye disc. Ommatidia begin to form along the furrow, resulting in a graded series of ommatidial development across the anterior/posterior axis of the disc.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0045468	regulation of R8 cell spacing in compound eye	Any process that ensures that the R8 cells are selected in a precise progressive pattern so that they are evenly spaced throughout the eye disc.
	GO:0010906	regulation of glucose metabolic process	Any process that modulates the rate, frequency or extent of glucose metabolism. Glucose metabolic processes are the chemical reactions and pathways involving glucose, the aldohexose gluco-hexose.
	GO:0045610	regulation of hemocyte differentiation	Any process that modulates the frequency, rate or extent of hemocyte differentiation.
	GO:0007346	regulation of mitotic cell cycle	Any process that modulates the rate or extent of progress through the mitotic cell cycle.
	GO:0007431	salivary gland development	The process whose specific outcome is the progression of the salivary gland over time, from its formation to the mature structure. Salivary glands include any of the saliva-secreting exocrine glands of the oral cavity.
	GO:0016330	second mitotic wave involved in compound eye morphogenesis	A discrete cell cycle in the third instar eye imaginal disc after progression of the morphogenetic furrow that contributes to compound eye morphogenesis. It is essential for generation of a sufficient pool of uncommitted cells to develop complete ommatidia.
	GO:0007367	segment polarity determination	Division of the 14 parasegments of the embryo into anterior and posterior compartments; exemplified by the actions of the segment polarity gene products.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
	GO:0035277	spiracle morphogenesis, open tracheal system	The process in which the anatomical structures of a spiracle are generated and organized. Spiracles are the openings in the insect open tracheal system; externally they connect to the epidermis and internally they connect to the tracheal trunk.
	GO:0048865	stem cell fate commitment	The process in which the developmental fate of a cell becomes restricted such that it will develop into a stem cell.
	GO:0007421	stomatogastric nervous system development	The process whose specific outcome is the progression of the stomatogastric nervous system over time, from its formation to the mature structure.
	GO:0035202	tracheal pit formation in open tracheal system	Formation of the tracheal pits, the first tube-like structures to form in the open tracheal system. Once cells are determined to their tracheal cell fate, the tracheal pits arise by invagination of each ectodermal cluster of tracheal placode cells, between 5 and 7 hours after egg laying. An example of this is found in Drosophila melanogaster.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0035309	wing and notum subfield formation	The regionalization process that subdivides the wing imaginal disc into the wing and notum (body wall) subfields, thus determining whether cells ultimately differentiate wing or notum-specific structures.
	GO:0007472	wing disc morphogenesis	The process in which the anatomical structures derived from the wing disc are generated and organized. This includes the transformation of a wing imaginal disc from a monolayered epithelium in the larvae of holometabolous insects into recognizable adult structures including the wing hinge, wing blade and pleura.
	GO:0007473	wing disc proximal/distal pattern formation	The establishment, maintenance and elaboration of the proximal/distal axis of the wing disc, a precursor to the adult wing.
cellular component
	GO:0035230	cytoneme	A long, thin, polarized cell projection that contains actin and can extend for distances many times the diameter of the cell. Cytonemes represent extensions of cell cytoplasm and typically have a diameter of approximately 0.2um.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B,D (SPITZ_DROME | Q01083)

molecular function
	GO:0005154	epidermal growth factor receptor binding	Interacting selectively and non-covalently with the epidermal growth factor receptor.
	GO:0008317	gurken receptor binding	Interacting selectively and non-covalently with the gurken growth factor receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0000086	G2/M transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
	GO:0045470	R8 cell-mediated photoreceptor organization	The regionalization process that coordinates the recruitment and organization of other non-R8 photoreceptors by the R8 photoreceptor.
	GO:0048149	behavioral response to ethanol	Any process that results in a change in the behavior of an organism as a result of an ethanol stimulus.
	GO:0007298	border follicle cell migration	The directed movement of a border cell through the nurse cells to reach the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0046845	branched duct epithelial cell fate determination, open tracheal system	Allocation of a set number of cells to each primary branch in an open tracheal system, prior to the onset of cell migration. This establishes different domains of cells within the tracheal placode.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0035225	determination of genital disc primordium	Allocation of embryonic cells to the genital imaginal disc founder populations. Early in development at the blastoderm stage, the anlage of the genital disc of both sexes consists of three primordia: the female genital primoridum lcoated anteriorly, the anal primoridum located posteriorly, and the male gential primordium between the two.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0061331	epithelial cell proliferation involved in Malpighian tubule morphogenesis	The multiplication or reproduction of epithelial cells, resulting in the expansion of a cell population and contributing to the shaping of a Malpighian tubule.
	GO:0003015	heart process	A circulatory system process carried out by the heart. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0007476	imaginal disc-derived wing morphogenesis	The process in which the anatomical structures of the imaginal disc-derived wing are generated and organized. The wing is an appendage modified for flying.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0046673	negative regulation of compound eye retinal cell programmed cell death	Any process that stops, prevents, or reduces the frequency, rate or extent of programmed cell death that occurs in the compound eye retina.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0022008	neurogenesis	Generation of cells within the nervous system.
	GO:0007438	oenocyte development	The process whose specific outcome is the progression of the oenocyte over time, from its formation to the mature structure. The oenocytes are large secretory cells found in clusters underlying the epidermis of larval abdominal segments.
	GO:0008355	olfactory learning	Any process in an organism in which a relatively long-lasting adaptive behavioral change occurs in response to (repeated) exposure to an olfactory cue.
	GO:0007424	open tracheal system development	The process whose specific outcome is the progression of an open tracheal system over time, from its formation to the mature structure. An open tracheal system is a respiratory system, a branched network of epithelial tubes that supplies oxygen to target tissues via spiracles. An example of this is found in Drosophila melanogaster.
	GO:0007422	peripheral nervous system development	The process whose specific outcome is the progression of the peripheral nervous system over time, from its formation to the mature structure. The peripheral nervous system is one of the two major divisions of the nervous system. Nerves in the PNS connect the central nervous system (CNS) with sensory organs, other organs, muscles, blood vessels and glands.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045742	positive regulation of epidermal growth factor receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of epidermal growth factor receptor signaling pathway activity.
	GO:0050769	positive regulation of neurogenesis	Any process that activates or increases the frequency, rate or extent of neurogenesis, the origin and formation of neurons.
	GO:0007432	salivary gland boundary specification	Determination of where the salivary gland forms, the total number of salivary gland cells and how many cells are allocated to each of the specialised cell types within the salivary gland.
	GO:0016330	second mitotic wave involved in compound eye morphogenesis	A discrete cell cycle in the third instar eye imaginal disc after progression of the morphogenetic furrow that contributes to compound eye morphogenesis. It is essential for generation of a sufficient pool of uncommitted cells to develop complete ommatidia.
	GO:0035277	spiracle morphogenesis, open tracheal system	The process in which the anatomical structures of a spiracle are generated and organized. Spiracles are the openings in the insect open tracheal system; externally they connect to the epidermis and internally they connect to the tracheal trunk.
	GO:0048865	stem cell fate commitment	The process in which the developmental fate of a cell becomes restricted such that it will develop into a stem cell.
	GO:0007421	stomatogastric nervous system development	The process whose specific outcome is the progression of the stomatogastric nervous system over time, from its formation to the mature structure.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 16)

Sites (16, 16)

SS Bonds (47, 47)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (3, 8)

Gene Ontology (124, 149)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File