3HUS - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF RECOMBINANT GAMMA N308K FIBRINOGEN FRAGMENT D WITH THE PEPTIDE LIGAND GLY-PRO-ARG-PRO-AMIDE

Authors :   S. T. Lord, S. R. Bowley, N. Okumura

Date :   15 Jun 09 (Deposition) - 18 Aug 09 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.04

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,I,J
Biol. Unit 1: A,B,C,G,H  (1x)
Biol. Unit 2: D,E,F,I,J  (1x)

Keywords :   Fibrinogen Fragment D, Amyloid, Amyloidosis, Blood Coagulation, Disease Mutation, Disulfide Bond, Glycoprotein, Isopeptide Bond, Phosphoprotein, Secreted, Pyrrolidone Carboxylic Acid, Sulfation, Blood Clotting (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. R. Bowley, N. Okumura, S. T. Lord
Impaired Protofibril Formation In Fibrinogen Gamman308K Is Due To Altered D:D And "A:A" Interactions.
Biochemistry V. 48 8656 2009
PubMed-ID: 19650644 | Reference-DOI: 10.1021/BI900239B

Molecule 1 - FIBRINOGEN ALPHA CHAIN
	Chains	:	A, D
	Engineered	:	YES
	Expression System	:	CRICETULUS GRISEUS
	Expression System Plasmid	:	PMLP
	Expression System Taxid	:	10029
	Expression System Vector Type	:	PLASMID
	Gene	:	FGA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FIBRINOPEPTIDE A

Molecule 2 - FIBRINOGEN BETA CHAIN
	Chains	:	B, E
	Engineered	:	YES
	Expression System	:	CRICETULUS GRISEUS
	Expression System Plasmid	:	PMLP
	Expression System Taxid	:	10029
	Expression System Vector Type	:	PLASMID
	Gene	:	FGB
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FIBRINOPEPTIDE B

Molecule 3 - FIBRINOGEN GAMMA CHAIN
	Chains	:	C, F
	Engineered	:	YES
	Expression System	:	CRICETULUS GRISEUS
	Expression System Plasmid	:	PMLP
	Expression System Taxid	:	10029
	Expression System Vector Type	:	PLASMID
	Gene	:	FGG, PRO2061
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 4 - PEPTIDE LIGAND GLY-PRO-ARG-PRO-AMIDE
	Chains	:	G, H, I, J
	Engineered	:	YES
	Other Details	:	PEPTIDE LIGAND GLY-PRO-ARG-PRO-AMIDE
	Synthetic	:	YES

		1	2	3	4	5	6	7	8	9	10
Asymmetric Unit	:	A	B	C	D	E	F	G	H	I	J
Biological Unit 1 (1x)	:	A	B	C				G	H
Biological Unit 2 (1x)	:				D	E	F			I	J

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 10)

No.	Name	Count	Type	Full Name
1	CA	4	Ligand/Ion	CALCIUM ION
2	FUC	2	Ligand/Ion	ALPHA-L-FUCOSE
3	NAG	4	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Biological Unit 1 (2, 3)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	FUC	1	Ligand/Ion	ALPHA-L-FUCOSE
3	NAG	2	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Biological Unit 2 (2, 3)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION
2	FUC	1	Ligand/Ion	ALPHA-L-FUCOSE
3	NAG	2	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HOH B:1 , ASP B:381 , ASP B:383 , TRP B:385	BINDING SITE FOR RESIDUE CA B 2
02	AC2	SOFTWARE	NAG B:4 , FUC B:5 , MET B:361 , ASN B:364	BINDING SITE FOR RESIDUE NAG B 3
03	AC3	SOFTWARE	NAG B:3	BINDING SITE FOR RESIDUE NAG B 4
04	AC4	SOFTWARE	NAG B:3	BINDING SITE FOR RESIDUE FUC B 5
05	AC5	SOFTWARE	ASP C:318 , ASP C:320 , PHE C:322	BINDING SITE FOR RESIDUE CA C 1
06	AC6	SOFTWARE	HOH E:36 , ASP E:381 , ASP E:383 , TRP E:385	BINDING SITE FOR RESIDUE CA E 2
07	AC7	SOFTWARE	NAG E:4 , FUC E:5 , MET E:361 , ASN E:364 , PRO J:4	BINDING SITE FOR RESIDUE NAG E 3
08	AC8	SOFTWARE	NAG E:3	BINDING SITE FOR RESIDUE NAG E 4
09	AC9	SOFTWARE	NAG E:3	BINDING SITE FOR RESIDUE FUC E 5
10	BC1	SOFTWARE	ASP F:318 , ASP F:320 , PHE F:322 , GLU F:323 , GLY F:324	BINDING SITE FOR RESIDUE CA F 1

Asymmetric Unit

No.	Residues
1	A:161	-	C:135
2	A:165	-	B:193
3	B:197	-	C:139
4	B:201	-	B:286
5	B:211	-	B:240
6	B:394	-	B:407
7	C:153	-	C:182
8	C:326	-	C:339
9	D:161	-	F:135
10	D:165	-	E:193
11	E:197	-	F:139
12	E:201	-	E:286
13	E:211	-	E:240
14	E:394	-	E:407
15	F:153	-	F:182
16	F:326	-	F:339

Asymmetric Unit

No.	Residues
1	Arg B:406	-	Cys B:407
2	Lys C:338	-	Cys C:339
3	Arg E:406	-	Cys E:407
4	Lys F:338	-	Cys F:339

Asymmetric Unit (31, 62)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_033930	Y	140	H	FIBG_HUMAN	Polymorphism	2066870	C/F	Y	114	H
02	UniProt	VAR_002399	R	160	S	FIBA_HUMAN	Unclassified	---	A/D	R	141	S
03	UniProt	VAR_014170	G	191	R	FIBG_HUMAN	Polymorphism	6063	C/F	G	165	R
04	UniProt	VAR_072723	C	184	W	FIBA_HUMAN	Disease (CAFBN)	---	A/D	C	165	W
05	UniProt	VAR_016908	R	196	C	FIBB_HUMAN	Disease (CAFBN)	121909623	B/E	R	166	C
06	UniProt	VAR_072620	L	202	Q	FIBB_HUMAN	Disease (CAFBN)	121909624	B/E	L	172	Q
07	UniProt	VAR_013093	P	265	L	FIBB_HUMAN	Polymorphism	6054	B/E	P	235	L
08	UniProt	VAR_002409	R	301	C	FIBG_HUMAN	Polymorphism	121913087	C/F	R	275	C
09	UniProt	VAR_002410	R	301	H	FIBG_HUMAN	Disease (DYSFIBRIN)	121913088	C/F	R	275	H
10	UniProt	VAR_072726	T	303	P	FIBG_HUMAN	Disease (CAFBN)	---	C/F	T	277	P
11	UniProt	VAR_002411	G	318	V	FIBG_HUMAN	Disease (DYSFIBRIN)	121913089	C/F	G	292	V
12	UniProt	VAR_072727	D	327	H	FIBG_HUMAN	Disease (CAFBN)	---	C/F	D	301	H
13	UniProt	VAR_002413	N	334	I	FIBG_HUMAN	Polymorphism	121913090	C/F	K	308	I
14	UniProt	VAR_002412	N	334	K	FIBG_HUMAN	Unclassified	---	C/F	K	308	K
15	UniProt	VAR_015853	G	335	D	FIBG_HUMAN	Unclassified	---	C/F	G	309	D
16	UniProt	VAR_002414	M	336	T	FIBG_HUMAN	Polymorphism	121913091	C/F	M	310	T
17	UniProt	VAR_072728	N	345	D	FIBG_HUMAN	Disease (CAFBN)	---	C/F	N	319	D
18	UniProt	VAR_002416	Q	355	R	FIBG_HUMAN	Polymorphism	121913092	C/F	Q	329	R
19	UniProt	VAR_002418	D	356	V	FIBG_HUMAN	Disease (DYSFIBRIN)	121913094	C/F	D	330	V
20	UniProt	VAR_002417	D	356	Y	FIBG_HUMAN	Polymorphism	121913093	C/F	D	330	Y
21	UniProt	VAR_002407	A	365	T	FIBB_HUMAN	Polymorphism	121909617	B/E	A	335	T
22	UniProt	VAR_002419	N	363	K	FIBG_HUMAN	Unclassified	---	C/F	N	337	K
23	UniProt	VAR_016909	L	383	R	FIBB_HUMAN	Disease (CAFBN)	121909621	B/E	L	353	R
24	UniProt	VAR_002421	S	384	C	FIBG_HUMAN	Unclassified	---	C/F	S	358	C
25	UniProt	VAR_002422	R	401	G	FIBG_HUMAN	Polymorphism	75848804	C/F	R	375	G
26	UniProt	VAR_072729	R	401	W	FIBG_HUMAN	Disease (CAFBN)	75848804	C/F	R	375	W
27	UniProt	VAR_072725	T	407	K	FIBB_HUMAN	Disease (CAFBN)	---	B/E	T	377	K
28	UniProt	VAR_072621	S	404	P	FIBG_HUMAN	Disease (DYSFIBRIN)	587777720	C/F	S	378	P
29	UniProt	VAR_014171	M	410	V	FIBG_HUMAN	Polymorphism	6061	C/F	M	384	V
30	UniProt	VAR_016910	G	430	D	FIBB_HUMAN	Disease (CAFBN)	121909622	B/E	G	400	D
31	UniProt	VAR_002408	R	478	K	FIBB_HUMAN	Polymorphism	4220	B/E	R	448	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (31, 31)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_033930	Y	140	H	FIBG_HUMAN	Polymorphism	2066870	C	Y	114	H
02	UniProt	VAR_002399	R	160	S	FIBA_HUMAN	Unclassified	---	A	R	141	S
03	UniProt	VAR_014170	G	191	R	FIBG_HUMAN	Polymorphism	6063	C	G	165	R
04	UniProt	VAR_072723	C	184	W	FIBA_HUMAN	Disease (CAFBN)	---	A	C	165	W
05	UniProt	VAR_016908	R	196	C	FIBB_HUMAN	Disease (CAFBN)	121909623	B	R	166	C
06	UniProt	VAR_072620	L	202	Q	FIBB_HUMAN	Disease (CAFBN)	121909624	B	L	172	Q
07	UniProt	VAR_013093	P	265	L	FIBB_HUMAN	Polymorphism	6054	B	P	235	L
08	UniProt	VAR_002409	R	301	C	FIBG_HUMAN	Polymorphism	121913087	C	R	275	C
09	UniProt	VAR_002410	R	301	H	FIBG_HUMAN	Disease (DYSFIBRIN)	121913088	C	R	275	H
10	UniProt	VAR_072726	T	303	P	FIBG_HUMAN	Disease (CAFBN)	---	C	T	277	P
11	UniProt	VAR_002411	G	318	V	FIBG_HUMAN	Disease (DYSFIBRIN)	121913089	C	G	292	V
12	UniProt	VAR_072727	D	327	H	FIBG_HUMAN	Disease (CAFBN)	---	C	D	301	H
13	UniProt	VAR_002413	N	334	I	FIBG_HUMAN	Polymorphism	121913090	C	K	308	I
14	UniProt	VAR_002412	N	334	K	FIBG_HUMAN	Unclassified	---	C	K	308	K
15	UniProt	VAR_015853	G	335	D	FIBG_HUMAN	Unclassified	---	C	G	309	D
16	UniProt	VAR_002414	M	336	T	FIBG_HUMAN	Polymorphism	121913091	C	M	310	T
17	UniProt	VAR_072728	N	345	D	FIBG_HUMAN	Disease (CAFBN)	---	C	N	319	D
18	UniProt	VAR_002416	Q	355	R	FIBG_HUMAN	Polymorphism	121913092	C	Q	329	R
19	UniProt	VAR_002418	D	356	V	FIBG_HUMAN	Disease (DYSFIBRIN)	121913094	C	D	330	V
20	UniProt	VAR_002417	D	356	Y	FIBG_HUMAN	Polymorphism	121913093	C	D	330	Y
21	UniProt	VAR_002407	A	365	T	FIBB_HUMAN	Polymorphism	121909617	B	A	335	T
22	UniProt	VAR_002419	N	363	K	FIBG_HUMAN	Unclassified	---	C	N	337	K
23	UniProt	VAR_016909	L	383	R	FIBB_HUMAN	Disease (CAFBN)	121909621	B	L	353	R
24	UniProt	VAR_002421	S	384	C	FIBG_HUMAN	Unclassified	---	C	S	358	C
25	UniProt	VAR_002422	R	401	G	FIBG_HUMAN	Polymorphism	75848804	C	R	375	G
26	UniProt	VAR_072729	R	401	W	FIBG_HUMAN	Disease (CAFBN)	75848804	C	R	375	W
27	UniProt	VAR_072725	T	407	K	FIBB_HUMAN	Disease (CAFBN)	---	B	T	377	K
28	UniProt	VAR_072621	S	404	P	FIBG_HUMAN	Disease (DYSFIBRIN)	587777720	C	S	378	P
29	UniProt	VAR_014171	M	410	V	FIBG_HUMAN	Polymorphism	6061	C	M	384	V
30	UniProt	VAR_016910	G	430	D	FIBB_HUMAN	Disease (CAFBN)	121909622	B	G	400	D
31	UniProt	VAR_002408	R	478	K	FIBB_HUMAN	Polymorphism	4220	B	R	448	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (31, 31)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_033930	Y	140	H	FIBG_HUMAN	Polymorphism	2066870	F	Y	114	H
02	UniProt	VAR_002399	R	160	S	FIBA_HUMAN	Unclassified	---	D	R	141	S
03	UniProt	VAR_014170	G	191	R	FIBG_HUMAN	Polymorphism	6063	F	G	165	R
04	UniProt	VAR_072723	C	184	W	FIBA_HUMAN	Disease (CAFBN)	---	D	C	165	W
05	UniProt	VAR_016908	R	196	C	FIBB_HUMAN	Disease (CAFBN)	121909623	E	R	166	C
06	UniProt	VAR_072620	L	202	Q	FIBB_HUMAN	Disease (CAFBN)	121909624	E	L	172	Q
07	UniProt	VAR_013093	P	265	L	FIBB_HUMAN	Polymorphism	6054	E	P	235	L
08	UniProt	VAR_002409	R	301	C	FIBG_HUMAN	Polymorphism	121913087	F	R	275	C
09	UniProt	VAR_002410	R	301	H	FIBG_HUMAN	Disease (DYSFIBRIN)	121913088	F	R	275	H
10	UniProt	VAR_072726	T	303	P	FIBG_HUMAN	Disease (CAFBN)	---	F	T	277	P
11	UniProt	VAR_002411	G	318	V	FIBG_HUMAN	Disease (DYSFIBRIN)	121913089	F	G	292	V
12	UniProt	VAR_072727	D	327	H	FIBG_HUMAN	Disease (CAFBN)	---	F	D	301	H
13	UniProt	VAR_002413	N	334	I	FIBG_HUMAN	Polymorphism	121913090	F	K	308	I
14	UniProt	VAR_002412	N	334	K	FIBG_HUMAN	Unclassified	---	F	K	308	K
15	UniProt	VAR_015853	G	335	D	FIBG_HUMAN	Unclassified	---	F	G	309	D
16	UniProt	VAR_002414	M	336	T	FIBG_HUMAN	Polymorphism	121913091	F	M	310	T
17	UniProt	VAR_072728	N	345	D	FIBG_HUMAN	Disease (CAFBN)	---	F	N	319	D
18	UniProt	VAR_002416	Q	355	R	FIBG_HUMAN	Polymorphism	121913092	F	Q	329	R
19	UniProt	VAR_002418	D	356	V	FIBG_HUMAN	Disease (DYSFIBRIN)	121913094	F	D	330	V
20	UniProt	VAR_002417	D	356	Y	FIBG_HUMAN	Polymorphism	121913093	F	D	330	Y
21	UniProt	VAR_002407	A	365	T	FIBB_HUMAN	Polymorphism	121909617	E	A	335	T
22	UniProt	VAR_002419	N	363	K	FIBG_HUMAN	Unclassified	---	F	N	337	K
23	UniProt	VAR_016909	L	383	R	FIBB_HUMAN	Disease (CAFBN)	121909621	E	L	353	R
24	UniProt	VAR_002421	S	384	C	FIBG_HUMAN	Unclassified	---	F	S	358	C
25	UniProt	VAR_002422	R	401	G	FIBG_HUMAN	Polymorphism	75848804	F	R	375	G
26	UniProt	VAR_072729	R	401	W	FIBG_HUMAN	Disease (CAFBN)	75848804	F	R	375	W
27	UniProt	VAR_072725	T	407	K	FIBB_HUMAN	Disease (CAFBN)	---	E	T	377	K
28	UniProt	VAR_072621	S	404	P	FIBG_HUMAN	Disease (DYSFIBRIN)	587777720	F	S	378	P
29	UniProt	VAR_014171	M	410	V	FIBG_HUMAN	Polymorphism	6061	F	M	384	V
30	UniProt	VAR_016910	G	430	D	FIBB_HUMAN	Disease (CAFBN)	121909622	E	G	400	D
31	UniProt	VAR_002408	R	478	K	FIBB_HUMAN	Polymorphism	4220	E	R	448	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FIBRINOGEN_C_2	PS51406	Fibrinogen C-terminal domain profile.	FIBG_HUMAN	170-416	2	C:144-390 F:144-390
1	FIBRINOGEN_C_2	PS51406	Fibrinogen C-terminal domain profile.	FIBB_HUMAN	232-488	2	B:202-458 E:202-458
2	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	FIBG_HUMAN	360-372	2	C:334-346 F:334-346
2	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	FIBB_HUMAN	432-444	2	B:402-414 E:402-414

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FIBRINOGEN_C_2	PS51406	Fibrinogen C-terminal domain profile.	FIBG_HUMAN	170-416	1	C:144-390 -
1	FIBRINOGEN_C_2	PS51406	Fibrinogen C-terminal domain profile.	FIBB_HUMAN	232-488	1	B:202-458 -
2	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	FIBG_HUMAN	360-372	1	C:334-346 -
2	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	FIBB_HUMAN	432-444	1	B:402-414 -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FIBRINOGEN_C_2	PS51406	Fibrinogen C-terminal domain profile.	FIBG_HUMAN	170-416	1	- F:144-390
1	FIBRINOGEN_C_2	PS51406	Fibrinogen C-terminal domain profile.	FIBB_HUMAN	232-488	1	- E:202-458
2	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	FIBG_HUMAN	360-372	1	- F:334-346
2	FIBRINOGEN_C_1	PS00514	Fibrinogen C-terminal domain signature.	FIBB_HUMAN	432-444	1	- E:402-414

Asymmetric Unit (13, 26)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000302053	1a	ENSE00001909776	chr4:155511918-155511786	133	FIBA_HUMAN	1-18	18	0	-	-
1.2	ENST00000302053	2	ENSE00001127292	chr4:155510714-155510589	126	FIBA_HUMAN	19-60	42	0	-	-
1.3	ENST00000302053	3	ENSE00001127283	chr4:155510128-155509945	184	FIBA_HUMAN	61-122	62	0	-	-
1.4b	ENST00000302053	4b	ENSE00001127274	chr4:155508809-155508664	146	FIBA_HUMAN	122-170	49	2	A:130-151 D:130-151	22 22
1.5b	ENST00000302053	5b	ENSE00001127263	chr4:155508070-155506690	1381	FIBA_HUMAN	171-631	461	2	A:152-190 D:152-190	39 39
1.6	ENST00000302053	6	ENSE00001210975	chr4:155505985-155504278	1708	FIBA_HUMAN	631-866	236	0	-	-

2.1a	ENST00000302068	1a	ENSE00001171218	chr4:155484108-155484284	177	FIBB_HUMAN	1-38	38	0	-	-
2.2d	ENST00000302068	2d	ENSE00001640255	chr4:155486960-155487151	192	FIBB_HUMAN	39-102	64	0	-	-
2.3b	ENST00000302068	3b	ENSE00001645081	chr4:155487641-155487824	184	FIBB_HUMAN	103-164	62	0	-	-
2.4b	ENST00000302068	4b	ENSE00001127321	chr4:155488745-155488972	228	FIBB_HUMAN	164-240	77	2	B:156-210 E:156-210	55 55
2.5	ENST00000302068	5	ENSE00001127313	chr4:155489533-155489646	114	FIBB_HUMAN	240-278	39	2	B:210-248 E:210-248	39 39
2.6	ENST00000302068	6	ENSE00001127308	chr4:155490334-155490459	126	FIBB_HUMAN	278-320	43	2	B:248-290 E:248-290	43 43
2.7	ENST00000302068	7	ENSE00001127300	chr4:155490666-155490951	286	FIBB_HUMAN	320-415	96	2	B:290-385 E:290-385	96 96
2.8c	ENST00000302068	8c	ENSE00001171210	chr4:155491571-155492238	668	FIBB_HUMAN	415-491	77	2	B:385-458 E:385-458	74 74

3.1f	ENST00000336098	1f	ENSE00001820766	chr4:155533800-155533684	117	FIBG_HUMAN	1-26	26	0	-	-
3.2a	ENST00000336098	2a	ENSE00001781463	chr4:155533587-155533543	45	FIBG_HUMAN	27-41	15	0	-	-
3.2d	ENST00000336098	2d	ENSE00001624767	chr4:155533353-155533170	184	FIBG_HUMAN	42-103	62	0	-	-
3.2g	ENST00000336098	2g	ENSE00001652916	chr4:155533050-155532957	94	FIBG_HUMAN	103-134	32	2	C:104-108 F:102-108	5 7
3.3a	ENST00000336098	3a	ENSE00001127239	chr4:155531349-155531219	131	FIBG_HUMAN	134-178	45	2	C:108-152 F:108-152	45 45
3.3f	ENST00000336098	3f	ENSE00002146570	chr4:155530915-155530782	134	FIBG_HUMAN	178-222	45	2	C:152-196 F:152-196	45 45
3.4b	ENST00000336098	4b	ENSE00001127220	chr4:155529802-155529618	185	FIBG_HUMAN	223-284	62	2	C:197-258 F:197-258	62 62
3.5	ENST00000336098	5	ENSE00001127212	chr4:155528134-155527857	278	FIBG_HUMAN	284-377	94	2	C:258-351 F:258-351	94 94
3.6c	ENST00000336098	6c	ENSE00001344514	chr4:155526218-155525728	491	FIBG_HUMAN	377-453	77	2	C:351-394 F:351-394	44 44

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:61
 aligned with FIBA_HUMAN | P02671 from UniProtKB/Swiss-Prot  Length:866

    Alignment length:61
                                   158       168       178       188       198       208 
           FIBA_HUMAN   149 VQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA 209
               SCOP domains ------------------------------------------------------------- SCOP domains
               CATH domains 3husA00 A:130-190  [code=1.20.5.50, no name defined]          CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------S-----------------------W------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4b [INCOMPLETE]Exon 1.5b  PDB: A:152-190 [INCOMPLETE]  Transcript 1
                 3hus A 130 VQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA 190
                                   139       149       159       169       179       189

Chain B from PDB  Type:PROTEIN  Length:303
 aligned with FIBB_HUMAN | P02675 from UniProtKB/Swiss-Prot  Length:491

    Alignment length:303
                                   195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485   
           FIBB_HUMAN   186 TVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF 488
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee...ee.....hhhhhhhhh.....eeee........eeeeee.......eeeeeee.........hhhhhhhhee..ee.........ee..ee.hhhhhhhhhhh..eeeeeeee.....eeeeeeeeeee.hhhhh..eeeeeeee..............hhhhhh..........................................ee........................ee...........eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------C-----Q--------------------------------------------------------------L---------------------------------------------------------------------------------------------------T-----------------R-----------------------K----------------------D-----------------------------------------------K---------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------FIBRINOGEN_C_2  PDB: B:202-458 UniProt: 232-488                                                                                                                                                                                                                   PROSITE (2)
                PROSITE (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_-------------------------------------------- PROSITE (1)
           Transcript 2 (1) Exon 2.4b  PDB: B:156-210 UniProt: 164-240 [INCOMPLETE]-------------------------------------Exon 2.6  PDB: B:248-290 UniProt: 278-320  ----------------------------------------------------------------------------------------------Exon 2.8c  PDB: B:385-458 UniProt: 415-491 [INCOMPLETE]                    Transcript 2 (1)
           Transcript 2 (2) ------------------------------------------------------Exon 2.5  PDB: B:210-248               -----------------------------------------Exon 2.7  PDB: B:290-385 UniProt: 320-415                                                       ------------------------------------------------------------------------- Transcript 2 (2)
                 3hus B 156 TVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF 458
                                   165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455

Chain C from PDB  Type:PROTEIN  Length:291
 aligned with FIBG_HUMAN | P02679 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:291
                                   139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419 
           FIBG_HUMAN   130 DSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI 420
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee...eeeeee.hhhhhhhhh....eeeee........eeeeeee.....eeeeeeee.........hhhhhhhheeee.......ee.hhhhhhhhhh.....eeeeeeee.....eeeeeeeeeee.......eee..eeee................hhhhhh....ee.............hhhhhhh..........ee........................ee...........eeeeeeee.hhhh. Sec.struct. author
             SAPs(SNPs) (1) ----------H--------------------------------------------------R-------------------------------------------------------------------------------------------------------------C-P--------------V--------H------IDT--------D---------RV------K--------------------C----------------G--P-----V---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------K---------------------Y--------------------------------------------W------------------- SAPs(SNPs) (2)
                PROSITE (1) ----------------------------------------FIBRINOGEN_C_2  PDB: C:144-390 UniProt: 170-416                                                                                                                                                                                                        ---- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_------------------------------------------------ PROSITE (3)
           Transcript 3 (1) 3.2g -------------------------------------------Exon 3.3f  PDB: C:152-196 UniProt: 178-222   Exon 3.4b  PDB: C:197-258 UniProt: 223-284                    --------------------------------------------------------------------------------------------Exon 3.6c  PDB: C:351-394 UniProt: 377-453   Transcript 3 (1)
           Transcript 3 (2) ----Exon 3.3a  PDB: C:108-152 UniProt: 134-178   ---------------------------------------------------------------------------------------------------------Exon 3.5  PDB: C:258-351 UniProt: 284-377                                                     ------------------------------------------- Transcript 3 (2)
                 3hus C 104 DSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHKGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI 394
                                   113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393

Chain D from PDB  Type:PROTEIN  Length:61
 aligned with FIBA_HUMAN | P02671 from UniProtKB/Swiss-Prot  Length:866

    Alignment length:61
                                   158       168       178       188       198       208 
           FIBA_HUMAN   149 VQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA 209
               SCOP domains ------------------------------------------------------------- SCOP domains
               CATH domains 3husD00 D:130-190  [code=1.20.5.50, no name defined]          CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------S-----------------------W------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4b [INCOMPLETE]Exon 1.5b  PDB: D:152-190 [INCOMPLETE]  Transcript 1
                 3hus D 130 VQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA 190
                                   139       149       159       169       179       189

Chain E from PDB  Type:PROTEIN  Length:303
 aligned with FIBB_HUMAN | P02675 from UniProtKB/Swiss-Prot  Length:491

    Alignment length:303
                                   195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485   
           FIBB_HUMAN   186 TVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF 488
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....ee...ee.....hhhhhhhhh.....eeee........eeeeee.hhhhh.eeeeeee.........hhhhhhhhee..ee.........ee..ee.hhhhhhhhhhh..eeeeeeee.....eeeeeeeeeee.hhhhh..eeeeeeee..............hhhhhh..........................................ee........................ee...........eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------C-----Q--------------------------------------------------------------L---------------------------------------------------------------------------------------------------T-----------------R-----------------------K----------------------D-----------------------------------------------K---------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------FIBRINOGEN_C_2  PDB: E:202-458 UniProt: 232-488                                                                                                                                                                                                                   PROSITE (2)
                PROSITE (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_-------------------------------------------- PROSITE (1)
           Transcript 2 (1) Exon 2.4b  PDB: E:156-210 UniProt: 164-240 [INCOMPLETE]-------------------------------------Exon 2.6  PDB: E:248-290 UniProt: 278-320  ----------------------------------------------------------------------------------------------Exon 2.8c  PDB: E:385-458 UniProt: 415-491 [INCOMPLETE]                    Transcript 2 (1)
           Transcript 2 (2) ------------------------------------------------------Exon 2.5  PDB: E:210-248               -----------------------------------------Exon 2.7  PDB: E:290-385 UniProt: 320-415                                                       ------------------------------------------------------------------------- Transcript 2 (2)
                 3hus E 156 TVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF 458
                                   165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455

Chain F from PDB  Type:PROTEIN  Length:293
 aligned with FIBG_HUMAN | P02679 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:293
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417   
           FIBG_HUMAN   128 THDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI 420
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....ee..........hhhhhhhhh....eeeee........eeeeeee.....eeeeeeee.........hhhhhhhheeee.......ee.hhhhhhhhhh.....eeeeeeee.....eeeeeeeeeee.hhhhh.eee................................ee..............................ee........................ee...........eeeeeeeehhhhh. Sec.struct. author
             SAPs(SNPs) (1) ------------H--------------------------------------------------R-------------------------------------------------------------------------------------------------------------C-P--------------V--------H------IDT--------D---------RV------K--------------------C----------------G--P-----V---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------K---------------------Y--------------------------------------------W------------------- SAPs(SNPs) (2)
                PROSITE (1) ------------------------------------------FIBRINOGEN_C_2  PDB: F:144-390 UniProt: 170-416                                                                                                                                                                                                        ---- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_------------------------------------------------ PROSITE (3)
           Transcript 3 (1) 3.2g   -------------------------------------------Exon 3.3f  PDB: F:152-196 UniProt: 178-222   Exon 3.4b  PDB: F:197-258 UniProt: 223-284                    --------------------------------------------------------------------------------------------Exon 3.6c  PDB: F:351-394 UniProt: 377-453   Transcript 3 (1)
           Transcript 3 (2) ------Exon 3.3a  PDB: F:108-152 UniProt: 134-178   ---------------------------------------------------------------------------------------------------------Exon 3.5  PDB: F:258-351 UniProt: 284-377                                                     ------------------------------------------- Transcript 3 (2)
                 3hus F 102 THDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHKGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI 394
                                   111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391

Chain G from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 3hus G   1 GPRP   4

Chain H from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 3hus H   1 GPRP   4

Chain I from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 3hus I   1 GPRP   4

Chain J from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 3hus J   1 GPRP   4

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3HUS)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Single alpha-helices involved in coiled-coils or other helix-helix interfaces (552)

Homologous Superfamily: [code=1.20.5.50, no name defined] (33)

Human (Homo sapiens) (28)

1a	3husA00	A:130-190
1b	3husD00	D:130-190

(no "Pfam Domain" information available for 3HUS)

Asymmetric Unit(hide GO term definitions)

Chain A,D (FIBA_HUMAN | P02671)

molecular function
	GO:0050839	cell adhesion molecule binding	Interacting selectively and non-covalently with a cell adhesion molecule.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030674	protein binding, bridging	The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
	GO:0006953	acute-phase response	An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0072377	blood coagulation, common pathway	A protein activation cascade that contributes to blood coagulation and consists of events leading from the formation of activated factor X to the formation of active thrombin, the cleavage of fibrinogen by thrombin, and the formation of cleaved fibrin into a stable multimeric, cross-linked complex.
	GO:0072378	blood coagulation, fibrin clot formation	A protein activation cascade that contributes to blood coagulation and consists of the cascade of enzymatic reactions initiated by physical damage to the wall of a blood vessel, leading to the formation of a formation of a fibrin clot at the site of the injury. The process also includes numerous positive and negative regulatory events.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0043623	cellular protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
	GO:0044267	cellular protein metabolic process	The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
	GO:0071345	cellular response to cytokine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:1990643	cellular response to granulocyte colony-stimulating factor	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a granulocyte colony-stimulating factor stimulus.
	GO:0071354	cellular response to interleukin-6	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-6 stimulus.
	GO:0071407	cellular response to organic cyclic compound	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0042730	fibrinolysis	A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
	GO:0007599	hemostasis	The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0043152	induction of bacterial agglutination	Any process in which infecting bacteria are clumped together by a host organism.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0097421	liver regeneration	The regrowth of lost or destroyed liver.
	GO:2000261	negative regulation of blood coagulation, common pathway	Any process that stops, prevents or reduces the frequency, rate or extent of blood coagulation, common pathway.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
	GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0031639	plasminogen activation	The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0045921	positive regulation of exocytosis	Any process that activates or increases the frequency, rate or extent of exocytosis.
	GO:0034116	positive regulation of heterotypic cell-cell adhesion	Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
	GO:0090277	positive regulation of peptide hormone secretion	Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
	GO:0050714	positive regulation of protein secretion	Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
	GO:0045907	positive regulation of vasoconstriction	Any process that activates or increases the frequency, rate or extent of vasoconstriction.
	GO:0006461	protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex.
	GO:0051258	protein polymerization	The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
	GO:0051592	response to calcium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0046898	response to cycloheximide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cycloheximide stimulus. Cycloheximide (actidione) is an antibiotic produced by some Streptomyces species which interferes with protein synthesis in eukaryotes.
	GO:0032355	response to estradiol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
	GO:0033595	response to genistein	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a genistein stimulus.
	GO:0043278	response to morphine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a morphine stimulus. Morphine is an opioid alkaloid, isolated from opium, with a complex ring structure.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:1903561	extracellular vesicle	Any vesicle that is part of the extracellular region.
	GO:0005577	fibrinogen complex	A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031091	platelet alpha granule	A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
	GO:0031093	platelet alpha granule lumen	The volume enclosed by the membrane of the platelet alpha granule.
	GO:0005791	rough endoplasmic reticulum	The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.

Chain B,E (FIBB_HUMAN | P02675)

molecular function
	GO:0050839	cell adhesion molecule binding	Interacting selectively and non-covalently with a cell adhesion molecule.
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030674	protein binding, bridging	The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0072378	blood coagulation, fibrin clot formation	A protein activation cascade that contributes to blood coagulation and consists of the cascade of enzymatic reactions initiated by physical damage to the wall of a blood vessel, leading to the formation of a formation of a fibrin clot at the site of the injury. The process also includes numerous positive and negative regulatory events.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0043623	cellular protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
	GO:0071347	cellular response to interleukin-1	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-1 stimulus.
	GO:0044320	cellular response to leptin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a leptin stimulus. Leptin is a hormone manufactured primarily in the adipocytes of white adipose tissue, and the level of circulating leptin is directly proportional to the total amount of fat in the body. It plays a key role in regulating energy intake and energy expenditure, including appetite and metabolism.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0042730	fibrinolysis	A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
	GO:0007599	hemostasis	The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0043152	induction of bacterial agglutination	Any process in which infecting bacteria are clumped together by a host organism.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
	GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0031639	plasminogen activation	The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0045921	positive regulation of exocytosis	Any process that activates or increases the frequency, rate or extent of exocytosis.
	GO:0034116	positive regulation of heterotypic cell-cell adhesion	Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
	GO:0090277	positive regulation of peptide hormone secretion	Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
	GO:0050714	positive regulation of protein secretion	Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
	GO:0045907	positive regulation of vasoconstriction	Any process that activates or increases the frequency, rate or extent of vasoconstriction.
	GO:0051258	protein polymerization	The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
	GO:0051592	response to calcium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:1903561	extracellular vesicle	Any vesicle that is part of the extracellular region.
	GO:0005577	fibrinogen complex	A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031091	platelet alpha granule	A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
	GO:0031093	platelet alpha granule lumen	The volume enclosed by the membrane of the platelet alpha granule.

Chain C,F (FIBG_HUMAN | P02679)

molecular function
	GO:0050839	cell adhesion molecule binding	Interacting selectively and non-covalently with a cell adhesion molecule.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030674	protein binding, bridging	The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0072378	blood coagulation, fibrin clot formation	A protein activation cascade that contributes to blood coagulation and consists of the cascade of enzymatic reactions initiated by physical damage to the wall of a blood vessel, leading to the formation of a formation of a fibrin clot at the site of the injury. The process also includes numerous positive and negative regulatory events.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0043623	cellular protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0042730	fibrinolysis	A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
	GO:0007599	hemostasis	The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
	GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0031639	plasminogen activation	The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0045921	positive regulation of exocytosis	Any process that activates or increases the frequency, rate or extent of exocytosis.
	GO:0034116	positive regulation of heterotypic cell-cell adhesion	Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
	GO:0090277	positive regulation of peptide hormone secretion	Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
	GO:0050714	positive regulation of protein secretion	Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
	GO:0045907	positive regulation of vasoconstriction	Any process that activates or increases the frequency, rate or extent of vasoconstriction.
	GO:0051258	protein polymerization	The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
	GO:0009306	protein secretion	The controlled release of proteins from a cell.
	GO:0051592	response to calcium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0072562	blood microparticle	A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005577	fibrinogen complex	A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0031091	platelet alpha granule	A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
	GO:0031093	platelet alpha granule lumen	The volume enclosed by the membrane of the platelet alpha granule.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FUC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg B:406 - Cys B:407	[ RasMol ]
		Arg E:406 - Cys E:407	[ RasMol ]
		Lys C:338 - Cys C:339	[ RasMol ]
		Lys F:338 - Cys F:339	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3hus
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FIBA_HUMAN \| P02671
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FIBB_HUMAN \| P02675
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FIBG_HUMAN \| P02679
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	202400
		Disease Information	:	OMIM
	616004
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FIBA_HUMAN \| P02671
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FIBB_HUMAN \| P02675
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FIBG_HUMAN \| P02679
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1lt9	WILD TYPE PROTEIN WITHOUT ANY PEPTIDE LIGAND
1ltj	WILD TYPE PROTEIN WITH BOTH THE PEPTIDE LIGANDS, GLY-PRO- ARG-PRO AND GLY-HIS-ARG-PRO

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 10)

Sites (10, 10)

SS Bonds (16, 16)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (31, 62)

PROSITE Motifs (2, 8)

Exons (13, 26)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (65, 151)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File