Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FRAGMENT D FROM HUMAN FIBRINOGEN WITH THE PEPTIDE LIGAND GLY-HIS-ARG-PRO-AMIDE
 
Authors :  S. J. Everse, G. Spraggon, L. Veerapandian, R. F. Doolittle
Date :  01 Jan 99  (Deposition) - 08 Jun 99  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F,M,N,S,T
Keywords :  Blood Coagulation, Plasma, Platelet, Fibrinogen, Fibrin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. J. Everse, G. Spraggon, L. Veerapandian, R. F. Doolittle
Conformational Changes In Fragments D And Double-D From Human Fibrin(Ogen) Upon Binding The Peptide Ligand Gly-His-Arg-Pro-Amide.
Biochemistry V. 38 2941 1999
PubMed-ID: 10074346  |  Reference-DOI: 10.1021/BI982626W

(-) Compounds

Molecule 1 - FIBRINOGEN
    Chains: A, D
    Fragment: FRAGMENT DOUBLE-D
    Organ: BLOOD
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Tissue: BLOOD
 
Molecule 2 - FIBRINOGEN
    Chains: B, E
    Fragment: FRAGMENT DOUBLE-D
    Organ: BLOOD
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Tissue: BLOOD
 
Molecule 3 - FIBRINOGEN
    Chains: C, F
    Fragment: FRAGMENT DOUBLE-D
    Organ: BLOOD
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Tissue: BLOOD
 
Molecule 4 - FIBRINOGEN
    Chains: S, T, M, N
    Fragment: FRAGMENT DOUBLE-D
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Tissue: BLOOD

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric/Biological Unit : ABCDEFMNST

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 12)

Asymmetric/Biological Unit (2, 12)
No.NameCountTypeFull Name
1CA8Ligand/IonCALCIUM ION
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREMET B:361 , ASN B:364 , NAG B:471 , HIS M:2 , PRO M:4BINDING SITE FOR RESIDUE NAG B 470
02AC2SOFTWARENAG B:470BINDING SITE FOR RESIDUE NAG B 471
03AC3SOFTWAREHOH E:40 , MET E:361 , ASN E:364 , NAG E:471BINDING SITE FOR RESIDUE NAG E 470
04AC4SOFTWARENAG E:470BINDING SITE FOR RESIDUE NAG E 471
05AC5SOFTWAREASP B:381 , ASP B:383 , TRP B:385 , HOH B:477BINDING SITE FOR RESIDUE CA B 2
06AC6SOFTWAREASP B:261 , GLY B:263 , GLU C:132BINDING SITE FOR RESIDUE CA B 3
07AC7SOFTWAREASP C:318 , ASP C:320 , PHE C:322 , GLY C:324 , HOH C:416BINDING SITE FOR RESIDUE CA C 1
08AC8SOFTWAREASP C:294 , GLY C:296 , ASP C:298 , ASP C:301 , HOH C:408BINDING SITE FOR RESIDUE CA C 4
09AC9SOFTWAREHOH E:88 , ASP E:381 , ASP E:383 , TRP E:385BINDING SITE FOR RESIDUE CA E 2
10BC1SOFTWAREASP E:261 , GLY E:263 , GLU F:132 , HOH F:416BINDING SITE FOR RESIDUE CA E 3
11BC2SOFTWAREASP F:318 , ASP F:320 , PHE F:322 , GLY F:324 , HOH F:407BINDING SITE FOR RESIDUE CA F 1
12BC3SOFTWAREASP F:294 , GLY F:296 , ASP F:298 , ASP F:301BINDING SITE FOR RESIDUE CA F 4

(-) SS Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1A:161 -C:135
2A:165 -B:193
3B:197 -C:139
4B:201 -B:286
5B:211 -B:240
6B:394 -B:407
7C:153 -C:182
8C:326 -C:339
9D:161 -F:135
10D:165 -E:193
11E:197 -F:139
12E:201 -E:286
13E:211 -E:240
14E:394 -E:407
15F:153 -F:182
16F:326 -F:339

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Arg B:406 -Cys B:407
2Lys C:338 -Cys C:339
3Arg E:406 -Cys E:407
4Lys F:338 -Cys F:339

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (31, 62)

Asymmetric/Biological Unit (31, 62)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_033930Y140HFIBG_HUMANPolymorphism2066870C/FY114H
02UniProtVAR_002399R160SFIBA_HUMANUnclassified  ---A/DR141S
03UniProtVAR_014170G191RFIBG_HUMANPolymorphism6063C/FG165R
04UniProtVAR_072723C184WFIBA_HUMANDisease (CAFBN)  ---A/DC165W
05UniProtVAR_016908R196CFIBB_HUMANDisease (CAFBN)121909623B/ER166C
06UniProtVAR_072620L202QFIBB_HUMANDisease (CAFBN)121909624B/EL172Q
07UniProtVAR_013093P265LFIBB_HUMANPolymorphism6054B/EP235L
08UniProtVAR_002409R301CFIBG_HUMANPolymorphism121913087C/FR275C
09UniProtVAR_002410R301HFIBG_HUMANDisease (DYSFIBRIN)121913088C/FR275H
10UniProtVAR_072726T303PFIBG_HUMANDisease (CAFBN)  ---C/FT277P
11UniProtVAR_002411G318VFIBG_HUMANDisease (DYSFIBRIN)121913089C/FG292V
12UniProtVAR_072727D327HFIBG_HUMANDisease (CAFBN)  ---C/FD301H
13UniProtVAR_002413N334IFIBG_HUMANPolymorphism121913090C/FN308I
14UniProtVAR_002412N334KFIBG_HUMANUnclassified  ---C/FN308K
15UniProtVAR_015853G335DFIBG_HUMANUnclassified  ---C/FG309D
16UniProtVAR_002414M336TFIBG_HUMANPolymorphism121913091C/FM310T
17UniProtVAR_072728N345DFIBG_HUMANDisease (CAFBN)  ---C/FN319D
18UniProtVAR_002416Q355RFIBG_HUMANPolymorphism121913092C/FQ329R
19UniProtVAR_002418D356VFIBG_HUMANDisease (DYSFIBRIN)121913094C/FD330V
20UniProtVAR_002417D356YFIBG_HUMANPolymorphism121913093C/FD330Y
21UniProtVAR_002407A365TFIBB_HUMANPolymorphism121909617B/EA335T
22UniProtVAR_002419N363KFIBG_HUMANUnclassified  ---C/FN337K
23UniProtVAR_016909L383RFIBB_HUMANDisease (CAFBN)121909621B/EL353R
24UniProtVAR_002421S384CFIBG_HUMANUnclassified  ---C/FS358C
25UniProtVAR_002422R401GFIBG_HUMANPolymorphism75848804C/FR375G
26UniProtVAR_072729R401WFIBG_HUMANDisease (CAFBN)75848804C/FR375W
27UniProtVAR_072725T407KFIBB_HUMANDisease (CAFBN)  ---B/ET377K
28UniProtVAR_072621S404PFIBG_HUMANDisease (DYSFIBRIN)587777720C/FS378P
29UniProtVAR_014171M410VFIBG_HUMANPolymorphism6061C/FM384V
30UniProtVAR_016910G430DFIBB_HUMANDisease (CAFBN)121909622B/EG400D
31UniProtVAR_002408R478KFIBB_HUMANPolymorphism4220B/ER448K

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 8)

Asymmetric/Biological Unit (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FIBRINOGEN_C_2PS51406 Fibrinogen C-terminal domain profile.FIBG_HUMAN170-416
 
  2C:144-390
F:144-390
FIBB_HUMAN232-488
 
  2B:202-458
E:202-458
2FIBRINOGEN_C_1PS00514 Fibrinogen C-terminal domain signature.FIBG_HUMAN360-372
 
  2C:334-346
F:334-346
FIBB_HUMAN432-444
 
  2B:402-414
E:402-414

(-) Exons   (13, 25)

Asymmetric/Biological Unit (13, 25)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003020531aENSE00001909776chr4:155511918-155511786133FIBA_HUMAN1-18180--
1.2ENST000003020532ENSE00001127292chr4:155510714-155510589126FIBA_HUMAN19-60420--
1.3ENST000003020533ENSE00001127283chr4:155510128-155509945184FIBA_HUMAN61-122620--
1.4bENST000003020534bENSE00001127274chr4:155508809-155508664146FIBA_HUMAN122-170492A:126-151
D:135-151
26
17
1.5bENST000003020535bENSE00001127263chr4:155508070-1555066901381FIBA_HUMAN171-6314612A:152-192
D:152-188
41
37
1.6ENST000003020536ENSE00001210975chr4:155505985-1555042781708FIBA_HUMAN631-8662360--

2.1aENST000003020681aENSE00001171218chr4:155484108-155484284177FIBB_HUMAN1-38380--
2.2dENST000003020682dENSE00001640255chr4:155486960-155487151192FIBB_HUMAN39-102640--
2.3bENST000003020683bENSE00001645081chr4:155487641-155487824184FIBB_HUMAN103-164620--
2.4bENST000003020684bENSE00001127321chr4:155488745-155488972228FIBB_HUMAN164-240772B:157-210
E:164-210
54
47
2.5ENST000003020685ENSE00001127313chr4:155489533-155489646114FIBB_HUMAN240-278392B:210-248
E:210-248
39
39
2.6ENST000003020686ENSE00001127308chr4:155490334-155490459126FIBB_HUMAN278-320432B:248-290
E:248-290
43
43
2.7ENST000003020687ENSE00001127300chr4:155490666-155490951286FIBB_HUMAN320-415962B:290-385
E:290-385
96
96
2.8cENST000003020688cENSE00001171210chr4:155491571-155492238668FIBB_HUMAN415-491772B:385-459
E:385-459
75
75

3.1fENST000003360981fENSE00001820766chr4:155533800-155533684117FIBG_HUMAN1-26260--
3.2aENST000003360982aENSE00001781463chr4:155533587-15553354345FIBG_HUMAN27-41150--
3.2dENST000003360982dENSE00001624767chr4:155533353-155533170184FIBG_HUMAN42-103620--
3.2gENST000003360982gENSE00001652916chr4:155533050-15553295794FIBG_HUMAN103-134321C:102-108
-
7
-
3.3aENST000003360983aENSE00001127239chr4:155531349-155531219131FIBG_HUMAN134-178452C:108-152
F:109-152
45
44
3.3fENST000003360983fENSE00002146570chr4:155530915-155530782134FIBG_HUMAN178-222452C:152-196
F:152-196
45
45
3.4bENST000003360984bENSE00001127220chr4:155529802-155529618185FIBG_HUMAN223-284622C:197-258
F:197-258
62
62
3.5ENST000003360985ENSE00001127212chr4:155528134-155527857278FIBG_HUMAN284-377942C:258-351
F:258-351
94
94
3.6cENST000003360986cENSE00001344514chr4:155526218-155525728491FIBG_HUMAN377-453772C:351-393
F:351-393
43
43

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:67
 aligned with FIBA_HUMAN | P02671 from UniProtKB/Swiss-Prot  Length:866

    Alignment length:67
                                   154       164       174       184       194       204       
           FIBA_HUMAN   145 VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD 211
               SCOP domains d1fzga_ A: Fibrinogen alpha chain                                   SCOP domains
               CATH domains 1fzgA00 A:126-192  [code=1.20.5.50, no name defined]                CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------S-----------------------W--------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4b  PDB: A:126-151 Exon 1.5b  PDB: A:152-192 [INCOMPLETE]    Transcript 1
                 1fzg A 126 VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD 192
                                   135       145       155       165       175       185       

Chain B from PDB  Type:PROTEIN  Length:303
 aligned with FIBB_HUMAN | P02675 from UniProtKB/Swiss-Prot  Length:491

    Alignment length:303
                                   196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486   
           FIBB_HUMAN   187 VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP 489
               SCOP domains d1fzgb2 B:157-199 Fibrinogen beta chain    d1fzgb1 B:200-459 Fibrinogen C-terminal domains                                                                                                                                                                                                                      SCOP domains
               CATH domains ---------------------------------------------1fzgB01 B:202-349,B:449-458 Gamma Fibrinogen, chain A, domain 1                                                                                     1fzgB02 B:350-448 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2                            1fzgB01   - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhh.....hhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhh......eeeee........eeeee...hhh...eeeeee..........hhhhhh........................hhhhhhhhhh..eeeeeeee.....eeeeee.eeee........eeee.eee....hhhh......hhhhhhh.........................hhhhh.......................................hhhh.......eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------C-----Q--------------------------------------------------------------L---------------------------------------------------------------------------------------------------T-----------------R-----------------------K----------------------D-----------------------------------------------K----------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------FIBRINOGEN_C_2  PDB: B:202-458 UniProt: 232-488                                                                                                                                                                                                                  - PROSITE (2)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_--------------------------------------------- PROSITE (1)
           Transcript 2 (1) Exon 2.4b  PDB: B:157-210 UniProt: 164-240            -------------------------------------Exon 2.6  PDB: B:248-290 UniProt: 278-320  ----------------------------------------------------------------------------------------------Exon 2.8c  PDB: B:385-459 UniProt: 415-491 [INCOMPLETE]                     Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------------------Exon 2.5  PDB: B:210-248               -----------------------------------------Exon 2.7  PDB: B:290-385 UniProt: 320-415                                                       -------------------------------------------------------------------------- Transcript 2 (2)
                 1fzg B 157 VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP 459
                                   166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456   

Chain C from PDB  Type:PROTEIN  Length:292
 aligned with FIBG_HUMAN | P02679 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:292
                                   137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417  
           FIBG_HUMAN   128 THDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT 419
               SCOP domains d1fzgc2 C:102-141 Fibrinogen gamma chaind1fzgc1 C:142-393 Fibrinogen C-terminal domains                                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------1fzgC01 C:144-286,C:381-391 Gamma Fibrinogen, chain A, domain 1                                                                                1fzgC02 C:287-380 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2                       1fzgC01    -- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhhh.....eeeee........eeeeeee.....eeeeeeee..........hhhhhheee.........eee.hhhhhhhh......eeeeeeee.....eeeeeee......hhh.......eeee.....hhh.........hhhh.....................hhhhh..................................................eeeeeeeehhh.. Sec.struct. author
             SAPs(SNPs) (1) ------------H--------------------------------------------------R-------------------------------------------------------------------------------------------------------------C-P--------------V--------H------IDT--------D---------RV------K--------------------C----------------G--P-----V--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------K---------------------Y--------------------------------------------W------------------ SAPs(SNPs) (2)
                PROSITE (1) ------------------------------------------FIBRINOGEN_C_2  PDB: C:144-390 UniProt: 170-416                                                                                                                                                                                                        --- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_----------------------------------------------- PROSITE (3)
           Transcript 3 (1) 3.2g   -------------------------------------------Exon 3.3f  PDB: C:152-196 UniProt: 178-222   Exon 3.4b  PDB: C:197-258 UniProt: 223-284                    --------------------------------------------------------------------------------------------Exon 3.6c  PDB: C:351-393 UniProt: 377-453  Transcript 3 (1)
           Transcript 3 (2) ------Exon 3.3a  PDB: C:108-152 UniProt: 134-178   ---------------------------------------------------------------------------------------------------------Exon 3.5  PDB: C:258-351 UniProt: 284-377                                                     ------------------------------------------ Transcript 3 (2)
                 1fzg C 102 THDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT 393
                                   111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391  

Chain D from PDB  Type:PROTEIN  Length:54
 aligned with FIBA_HUMAN | P02671 from UniProtKB/Swiss-Prot  Length:866

    Alignment length:54
                                   163       173       183       193       203    
           FIBA_HUMAN   154 LLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQV 207
               SCOP domains d1fzgd_ D: Fibrinogen alpha chain                      SCOP domains
               CATH domains 1fzgD00 D:135-188  [code=1.20.5.50, no name defined]   CATH domains
               Pfam domains ------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------S-----------------------W----------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.4b        Exon 1.5b  PDB: D:152-188             Transcript 1
                 1fzg D 135 LLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQV 188
                                   144       154       164       174       184    

Chain E from PDB  Type:PROTEIN  Length:296
 aligned with FIBB_HUMAN | P02675 from UniProtKB/Swiss-Prot  Length:491

    Alignment length:296
                                   203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483      
           FIBB_HUMAN   194 NLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP 489
               SCOP domains d1fzge2 E:164-199                   d1fzge1 E:200-459 Fibrinogen C-terminal domains                                                                                                                                                                                                                      SCOP domains
               CATH domains --------------------------------------1fzgE01 E:202-349,E:449-458 Gamma Fibrinogen, chain A, domain 1                                                                                     1fzgE02 E:350-448 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2                            1fzgE01   - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhh.....eeeee........eeeee...hhh...eeeeee..........hhhhhh........................hhhhhhhhhh..eeeeeeee.....eeeeee.eeee........eeee.eee....hhhh......hhhhhhh...........................hhh.......................................hhhh.......eeeeeeee... Sec.struct. author
                 SAPs(SNPs) --C-----Q--------------------------------------------------------------L---------------------------------------------------------------------------------------------------T-----------------R-----------------------K----------------------D-----------------------------------------------K----------- SAPs(SNPs)
                PROSITE (2) --------------------------------------FIBRINOGEN_C_2  PDB: E:202-458 UniProt: 232-488                                                                                                                                                                                                                  - PROSITE (2)
                PROSITE (1) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_--------------------------------------------- PROSITE (1)
           Transcript 2 (1) Exon 2.4b  PDB: E:164-210 UniProt: 164-240     -------------------------------------Exon 2.6  PDB: E:248-290 UniProt: 278-320  ----------------------------------------------------------------------------------------------Exon 2.8c  PDB: E:385-459 UniProt: 415-491 [INCOMPLETE]                     Transcript 2 (1)
           Transcript 2 (2) ----------------------------------------------Exon 2.5  PDB: E:210-248               -----------------------------------------Exon 2.7  PDB: E:290-385 UniProt: 320-415                                                       -------------------------------------------------------------------------- Transcript 2 (2)
                 1fzg E 164 NLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP 459
                                   173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453      

Chain F from PDB  Type:PROTEIN  Length:285
 aligned with FIBG_HUMAN | P02679 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:285
                                   144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414     
           FIBG_HUMAN   135 YLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT 419
               SCOP domains d1fzgf2 F:109-141                d1fzgf1 F:142-393 Fibrinogen C-terminal domains                                                                                                                                                                                                              SCOP domains
               CATH domains -----------------------------------1fzgF01 F:144-286,F:381-391 Gamma Fibrinogen, chain A, domain 1                                                                                1fzgF02 F:287-380 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2                       1fzgF01    -- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhh.hhhhhhhhhhhhhhhhhh..................hhhhhhh.....eeeee........eeeeeee.....eeeeeeee..........hhhhhheee.........eee.hhhhhhhh......eeeeeeee.....eeeeeee......hhh................hhh.......hhhhhh.....................hhhhh.........................hhh......................eeeeeeeehhh.. Sec.struct. author
             SAPs(SNPs) (1) -----H--------------------------------------------------R-------------------------------------------------------------------------------------------------------------C-P--------------V--------H------IDT--------D---------RV------K--------------------C----------------G--P-----V--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------K---------------------Y--------------------------------------------W------------------ SAPs(SNPs) (2)
                PROSITE (1) -----------------------------------FIBRINOGEN_C_2  PDB: F:144-390 UniProt: 170-416                                                                                                                                                                                                        --- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FIBRINOGEN_C_----------------------------------------------- PROSITE (3)
           Transcript 3 (1) -------------------------------------------Exon 3.3f  PDB: F:152-196 UniProt: 178-222   Exon 3.4b  PDB: F:197-258 UniProt: 223-284                    --------------------------------------------------------------------------------------------Exon 3.6c  PDB: F:351-393 UniProt: 377-453  Transcript 3 (1)
           Transcript 3 (2) Exon 3.3a  PDB: F:109-152 UniProt: 134-178  ---------------------------------------------------------------------------------------------------------Exon 3.5  PDB: F:258-351 UniProt: 284-377                                                     ------------------------------------------ Transcript 3 (2)
                 1fzg F 109 YLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT 393
                                   118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388     

Chain M from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 1fzg M   1 GHRP   4

Chain N from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 1fzg N   1 GHRP   4

Chain S from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 1fzg S   1 GHRP   4

Chain T from PDB  Type:PROTEIN  Length:4
                                    
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---- SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 1fzg T   1 GHRP   4

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (5, 10)

Asymmetric/Biological Unit

(-) CATH Domains  (3, 10)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
1a1fzgC01C:144-286,C:381-391
1b1fzgB01B:202-349,B:449-458
1c1fzgE01E:202-349,E:449-458
1d1fzgF01F:144-286,F:381-391

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1FZG)

(-) Gene Ontology  (65, 151)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,D   (FIBA_HUMAN | P02671)
molecular function
    GO:0050839    cell adhesion molecule binding    Interacting selectively and non-covalently with a cell adhesion molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0006953    acute-phase response    An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0072377    blood coagulation, common pathway    A protein activation cascade that contributes to blood coagulation and consists of events leading from the formation of activated factor X to the formation of active thrombin, the cleavage of fibrinogen by thrombin, and the formation of cleaved fibrin into a stable multimeric, cross-linked complex.
    GO:0072378    blood coagulation, fibrin clot formation    A protein activation cascade that contributes to blood coagulation and consists of the cascade of enzymatic reactions initiated by physical damage to the wall of a blood vessel, leading to the formation of a formation of a fibrin clot at the site of the injury. The process also includes numerous positive and negative regulatory events.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0043623    cellular protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0071345    cellular response to cytokine stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:1990643    cellular response to granulocyte colony-stimulating factor    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a granulocyte colony-stimulating factor stimulus.
    GO:0071354    cellular response to interleukin-6    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-6 stimulus.
    GO:0071407    cellular response to organic cyclic compound    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0043152    induction of bacterial agglutination    Any process in which infecting bacteria are clumped together by a host organism.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0097421    liver regeneration    The regrowth of lost or destroyed liver.
    GO:2000261    negative regulation of blood coagulation, common pathway    Any process that stops, prevents or reduces the frequency, rate or extent of blood coagulation, common pathway.
    GO:2000352    negative regulation of endothelial cell apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
    GO:1902042    negative regulation of extrinsic apoptotic signaling pathway via death domain receptors    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
    GO:0031639    plasminogen activation    The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0070527    platelet aggregation    The adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0045921    positive regulation of exocytosis    Any process that activates or increases the frequency, rate or extent of exocytosis.
    GO:0034116    positive regulation of heterotypic cell-cell adhesion    Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
    GO:0090277    positive regulation of peptide hormone secretion    Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
    GO:0050714    positive regulation of protein secretion    Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
    GO:1900026    positive regulation of substrate adhesion-dependent cell spreading    Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    GO:0045907    positive regulation of vasoconstriction    Any process that activates or increases the frequency, rate or extent of vasoconstriction.
    GO:0006461    protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
    GO:0051592    response to calcium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0046898    response to cycloheximide    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cycloheximide stimulus. Cycloheximide (actidione) is an antibiotic produced by some Streptomyces species which interferes with protein synthesis in eukaryotes.
    GO:0032355    response to estradiol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0033595    response to genistein    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a genistein stimulus.
    GO:0043278    response to morphine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a morphine stimulus. Morphine is an opioid alkaloid, isolated from opium, with a complex ring structure.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:1903561    extracellular vesicle    Any vesicle that is part of the extracellular region.
    GO:0005577    fibrinogen complex    A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031091    platelet alpha granule    A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.
    GO:0005791    rough endoplasmic reticulum    The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.

Chain B,E   (FIBB_HUMAN | P02675)
molecular function
    GO:0050839    cell adhesion molecule binding    Interacting selectively and non-covalently with a cell adhesion molecule.
    GO:0051087    chaperone binding    Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0072378    blood coagulation, fibrin clot formation    A protein activation cascade that contributes to blood coagulation and consists of the cascade of enzymatic reactions initiated by physical damage to the wall of a blood vessel, leading to the formation of a formation of a fibrin clot at the site of the injury. The process also includes numerous positive and negative regulatory events.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0043623    cellular protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
    GO:0071347    cellular response to interleukin-1    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-1 stimulus.
    GO:0044320    cellular response to leptin stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a leptin stimulus. Leptin is a hormone manufactured primarily in the adipocytes of white adipose tissue, and the level of circulating leptin is directly proportional to the total amount of fat in the body. It plays a key role in regulating energy intake and energy expenditure, including appetite and metabolism.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0043152    induction of bacterial agglutination    Any process in which infecting bacteria are clumped together by a host organism.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:2000352    negative regulation of endothelial cell apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
    GO:1902042    negative regulation of extrinsic apoptotic signaling pathway via death domain receptors    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
    GO:0031639    plasminogen activation    The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0070527    platelet aggregation    The adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0045921    positive regulation of exocytosis    Any process that activates or increases the frequency, rate or extent of exocytosis.
    GO:0034116    positive regulation of heterotypic cell-cell adhesion    Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
    GO:0090277    positive regulation of peptide hormone secretion    Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
    GO:0050714    positive regulation of protein secretion    Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
    GO:1900026    positive regulation of substrate adhesion-dependent cell spreading    Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    GO:0045907    positive regulation of vasoconstriction    Any process that activates or increases the frequency, rate or extent of vasoconstriction.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
    GO:0051592    response to calcium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:1903561    extracellular vesicle    Any vesicle that is part of the extracellular region.
    GO:0005577    fibrinogen complex    A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031091    platelet alpha granule    A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.

Chain C,F   (FIBG_HUMAN | P02679)
molecular function
    GO:0050839    cell adhesion molecule binding    Interacting selectively and non-covalently with a cell adhesion molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0072378    blood coagulation, fibrin clot formation    A protein activation cascade that contributes to blood coagulation and consists of the cascade of enzymatic reactions initiated by physical damage to the wall of a blood vessel, leading to the formation of a formation of a fibrin clot at the site of the injury. The process also includes numerous positive and negative regulatory events.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0043623    cellular protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:2000352    negative regulation of endothelial cell apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
    GO:1902042    negative regulation of extrinsic apoptotic signaling pathway via death domain receptors    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
    GO:0031639    plasminogen activation    The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0070527    platelet aggregation    The adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0045921    positive regulation of exocytosis    Any process that activates or increases the frequency, rate or extent of exocytosis.
    GO:0034116    positive regulation of heterotypic cell-cell adhesion    Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
    GO:0090277    positive regulation of peptide hormone secretion    Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
    GO:0050714    positive regulation of protein secretion    Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
    GO:1900026    positive regulation of substrate adhesion-dependent cell spreading    Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    GO:0045907    positive regulation of vasoconstriction    Any process that activates or increases the frequency, rate or extent of vasoconstriction.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
    GO:0009306    protein secretion    The controlled release of proteins from a cell.
    GO:0051592    response to calcium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005577    fibrinogen complex    A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031091    platelet alpha granule    A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg B:406 - Cys B:407   [ RasMol ]  
    Arg E:406 - Cys E:407   [ RasMol ]  
    Lys C:338 - Cys C:339   [ RasMol ]  
    Lys F:338 - Cys F:339   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1fzg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FIBA_HUMAN | P02671
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FIBB_HUMAN | P02675
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FIBG_HUMAN | P02679
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  202400
    Disease Information: OMIM
  616004
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FIBA_HUMAN | P02671
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FIBB_HUMAN | P02675
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FIBG_HUMAN | P02679
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FIBA_HUMAN | P02671: 1bbr 1dm4 1fph 1fza 1fzb 1fzc 1fzd 1fze 1fzf 1lt9 1ltj 1n86 1n8e 1re3 1re4 1rf0 1rf1 1ycp 2a45 2ffd 2h43 2hlo 2hod 2hpc 2oyh 2oyi 2q9i 2xnx 2xny 2z4e 3at0 3bvh 3e1i 3ghg 3h32 3hus 4f27 5cfa
        FIBB_HUMAN | P02675: 1fza 1fzb 1fzc 1fze 1fzf 1lt9 1ltj 1n86 1n8e 1re3 1re4 1rf0 1rf1 2a45 2ffd 2h43 2hlo 2hod 2hpc 2oyh 2oyi 2q9i 2xnx 2xny 2z4e 3bvh 3e1i 3ghg 3h32 3hus
        FIBG_HUMAN | P02679: 1dug 1fib 1fic 1fid 1fza 1fzb 1fzc 1fze 1fzf 1lt9 1ltj 1n86 1n8e 1re3 1re4 1rf0 1rf1 2a45 2ffd 2fib 2h43 2hlo 2hod 2hpc 2hwl 2oyh 2oyi 2q9i 2vdo 2vdp 2vdq 2vdr 2vr3 2xnx 2xny 2y7l 2z4e 3bvh 3e1i 3fib 3ghg 3h32 3hus 4b60

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1FZG)