Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF FIBRINOGEN-AA PEPTIDE 1-23 (F8Y) BOUND TO BOVINE THROMBIN EXPLAINS WHY THE MUTATION OF PHE-8 TO TYROSINE STRONGLY INHIBITS NORMAL CLEAVAGE AT ARGININE-16
 
Authors :  M. G. Malkowski, B. F. P. Edwards
Date :  01 May 97  (Deposition) - 06 May 98  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  F,H,J,K,L,M,N
Biol. Unit 1:  F,H,L  (1x)
Biol. Unit 2:  J,K,M,N  (1x)
Keywords :  Fibrinopeptide-A, Complex (Serine Protease-Peptide), Thrombin, Hydrolase-Hydrolase Substrate Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. G. Malkowski, P. D. Martin, S. T. Lord, B. F. Edwards
Crystal Structure Of Fibrinogen-Aalpha Peptide 1-23 (F8Y) Bound To Bovine Thrombin Explains Why The Mutation Of Phe-8 To Tyrosine Strongly Inhibits Normal Cleavage At Arg-16.
Biochem. J. V. 326 815 1997
PubMed-ID: 9307032
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - EPSILON THROMBIN
    ChainsL, J
    EC Number3.4.21.5
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    TissueBLOOD
 
Molecule 2 - ALPHA THROMBIN
    ChainsH
    EC Number3.4.21.5
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    TissueBLOOD
 
Molecule 3 - FIBRINOPEPTIDE A-ALPHA
    ChainsF, N
    EngineeredYES
    FragmentRESIDUES 1 - 23
    MutationYES
 
Molecule 4 - EPSILON THROMBIN
    ChainsK
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    TissueBLOOD
 
Molecule 5 - EPSILON THROMBIN
    ChainsM
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    TissueBLOOD

 Structural Features

(-) Chains, Units

  1234567
Asymmetric Unit FHJKLMN
Biological Unit 1 (1x)FH  L  
Biological Unit 2 (1x)  JK MN

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1YCP)

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH F:450 , HOH F:481 , HOH F:482 , HOH F:668 , LEU H:41 , HIS H:57 , TYR H:60A , TRP H:96 , LYS H:97 , GLU H:97A , LEU H:99 , ILE H:174 , ASP H:189 , ALA H:190 , CYS H:191 , GLU H:192 , GLY H:193 , SER H:195 , SER H:214 , TRP H:215 , GLY H:216 , GLY H:219 , HOH H:411BINDING SITE FOR CHAIN F OF FIBRINOPEPTIDE A- ALPHA
2AC2SOFTWARETRP H:60D , HOH H:504 , HIS K:57 , LYS K:97 , GLU K:97A , HOH K:442 , HOH K:495 , ILE M:174 , ASP M:189 , GLU M:192 , GLY M:193 , SER M:195 , SER M:214 , TRP M:215 , GLY M:216 , GLY M:219BINDING SITE FOR CHAIN N OF FIBRINOPEPTIDE A- ALPHA

(-) SS Bonds  (8, 8)

Asymmetric Unit
No.Residues
1H:42 -H:58
2H:168 -H:182
3H:191 -H:220
4J:1 -K:122
5K:42 -K:58
6L:1 -H:122
7M:168 -M:182
8M:191 -M:220

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Ser H:36A-Pro H:37
2Ser K:36A-Pro K:37

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 8)

Asymmetric Unit (4, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_THRB_BOVIN_001 *D600NTHRB_BOVIN  ---  ---H/MD222N
2UniProtVAR_002392R35CFIBA_HUMANDisease (DYSFIBRIN)121909606F/NR316C
3UniProtVAR_002393R35HFIBA_HUMANPolymorphism121909607F/NR316H
4UniProtVAR_002394P37LFIBA_HUMANPolymorphism121909609F/NP318L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_THRB_BOVIN_001 *D600NTHRB_BOVIN  ---  ---HD222N
2UniProtVAR_002392R35CFIBA_HUMANDisease (DYSFIBRIN)121909606FR316C
3UniProtVAR_002393R35HFIBA_HUMANPolymorphism121909607FR316H
4UniProtVAR_002394P37LFIBA_HUMANPolymorphism121909609FP318L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_THRB_BOVIN_001 *D600NTHRB_BOVIN  ---  ---MD222N
2UniProtVAR_002392R35CFIBA_HUMANDisease (DYSFIBRIN)121909606NR316C
3UniProtVAR_002393R35HFIBA_HUMANPolymorphism121909607NR316H
4UniProtVAR_002394P37LFIBA_HUMANPolymorphism121909609NP318L
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.THRB_BOVIN367-621
 
  2H:16-243
K:16-146
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.THRB_BOVIN405-410
 
  2H:53-58
K:53-58
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.THRB_BOVIN565-576
 
  2H:189-200
M:189-200
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.THRB_BOVIN367-621
 
  1H:16-243
-
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.THRB_BOVIN405-410
 
  1H:53-58
-
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.THRB_BOVIN565-576
 
  1H:189-200
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.THRB_BOVIN367-621
 
  1-
K:16-146
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.THRB_BOVIN405-410
 
  1-
K:53-58
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.THRB_BOVIN565-576
 
  1-
M:189-200

(-) Exons   (8, 19)

Asymmetric Unit (8, 19)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSBTAT000000094061ENSBTAE00000076598chr15:77004894-77005007114THRB_BOVIN1-27270--
1.2ENSBTAT000000094062ENSBTAE00000076606chr15:77005352-77005515164THRB_BOVIN27-81550--
1.3ENSBTAT000000094063ENSBTAE00000306249chr15:77006130-7700615425THRB_BOVIN82-9090--
1.4ENSBTAT000000094064ENSBTAE00000076608chr15:77006384-7700643451THRB_BOVIN90-107180--
1.5ENSBTAT000000094065ENSBTAE00000076609chr15:77007812-77007917106THRB_BOVIN107-142360--
1.6ENSBTAT000000094066ENSBTAE00000076610chr15:77008015-77008151137THRB_BOVIN142-188470--
1.7ENSBTAT000000094067ENSBTAE00000076611chr15:77009362-77009676315THRB_BOVIN188-2931060--
1.8ENSBTAT000000094068ENSBTAE00000076614chr15:77009972-77010106135THRB_BOVIN293-338462-
J:1B-1A
-
L:1B-1A
-
-
2
-
2
-
1.9ENSBTAT000000094069ENSBTAE00000076615chr15:77010182-77010308127THRB_BOVIN338-380434H:16-29
J:1A-14M
K:16-29
L:1A-14M
-
14
28
14
28
-
1.10ENSBTAT0000000940610ENSBTAE00000076616chr15:77011290-77011457168THRB_BOVIN380-436572H:29-75
-
K:29-75
-
-
57
-
57
-
-
1.11ENSBTAT0000000940611ENSBTAE00000076617chr15:77011956-77012129174THRB_BOVIN436-494592H:75-129B
-
K:75-129B
-
-
59
-
59
-
-
1.12ENSBTAT0000000940612ENSBTAE00000306240chr15:77012378-77012559182THRB_BOVIN494-555623H:129B-184 (gaps)
-
K:129B-146
-
M:150-184
62
-
19
-
35
1.13ENSBTAT0000000940613ENSBTAE00000076620chr15:77018853-7701892371THRB_BOVIN555-578242H:184-202
-
-
-
M:184-202
24
-
-
-
24
1.14ENSBTAT0000000940614ENSBTAE00000076621chr15:77019058-77019320263THRB_BOVIN579-625472H:203-243 (gaps)
-
-
-
M:203-243 (gaps)
44
-
-
-
44

2.1aENST000003020531aENSE00001909776chr4:155511918-155511786133FIBA_HUMAN1-18180--
2.2ENST000003020532ENSE00001127292chr4:155510714-155510589126FIBA_HUMAN19-60422F:308-318 (gaps)
N:308-318 (gaps)
11
11
2.3ENST000003020533ENSE00001127283chr4:155510128-155509945184FIBA_HUMAN61-122620--
2.4bENST000003020534bENSE00001127274chr4:155508809-155508664146FIBA_HUMAN122-170490--
2.5bENST000003020535bENSE00001127263chr4:155508070-1555066901381FIBA_HUMAN171-6314610--
2.6ENST000003020536ENSE00001210975chr4:155505985-1555042781708FIBA_HUMAN631-8662360--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain F from PDB  Type:PROTEIN  Length:6
 aligned with FIBA_HUMAN | P02671 from UniProtKB/Swiss-Prot  Length:866

    Alignment length:11
                                    36 
          FIBA_HUMAN     27 FLAEGGGVRGP   37
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .-----..... Sec.struct. author
             SAPs(SNPs) (1) --------C-L SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------H-- SAPs(SNPs) (2)
                    PROSITE ----------- PROSITE
               Transcript 2 Exon 2.2    Transcript 2
                1ycp F  308 Y-----GVRGP  318
                            |     |317 
                            |   314    
                          308          

Chain H from PDB  Type:PROTEIN  Length:247
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:255
                                   376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616     
          THRB_BOVIN    367 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID  621
               SCOP domains d1ycp.1 L:,H: Thrombin                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1ycpH01     1ycpH02 H:28-120,H:233-242 Trypsin-like serine proteases                                                 1ycpH01 H:16-27,H:121-232 Try        psin-like serine proteases                                                                1ycpH02   - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee....eeeeeee.....eeee.hhh...hhh.....hhheeeee.............eee....eee..............eeee..................hhhhhhh.....eeeeee......--------......eeeeee...hhhhhhh........eeee...hhh.............eeeee......eeeeeeeeee.........eeeeehhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------N--------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: H:16-243 UniProt: 367-621                                                                                                                                                                                                                     PROSITE (1)
                PROSITE (2) --------------------------------------TRYPSI----------------------------------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER --------------------------------------------- PROSITE (2)
           Transcript 1 (1) -------------Exon 1.10  PDB: H:29-75 UniProt: 380-436                 ---------------------------------------------------------Exon 1.12  PDB: H:129B-184 (gaps) UniProt: 494-555            -----------------------Exon 1.14  PDB: H:203-243 (gaps)            Transcript 1 (1)
           Transcript 1 (2) Exon 1.9      -------------------------------------------------------Exon 1.11  PDB: H:75-129B UniProt: 436-494                 ------------------------------------------------------------Exon 1.13  PDB: H:184-20------------------------------------------- Transcript 1 (2)
                1ycp H   16 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRE--------VQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID  243
                                    25        35 |      44        54      |60D|||||   65        75  |     84        94   |   103       113       123      |130       140     |   -    |  155       165       175      184A  |||| 190       200    || 208       219  |    228       238     
                                               36A                      60A||||||||               77A                  97A                             129A||              146      150                               184A  ||||               204A|          217|  |                      
                                                                         60B|||||||                                                                     129B|                                                            186A|||                204B           219  |                      
                                                                          60C||||||                                                                      129C                                                             186B||                                 221A                      
                                                                           60D|||||                                                                                                                                        186C|                                                           
                                                                            60E||||                                                                                                                                         186D                                                           
                                                                             60F|||                                                                                                                                                                                                        
                                                                              60G||                                                                                                                                                                                                        
                                                                               60H|                                                                                                                                                                                                        
                                                                                60I                                                                                                                                                                                                        

Chain J from PDB  Type:PROTEIN  Length:29
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:29
                                   346       356         
          THRB_BOVIN    337 ADCGLRPLFEKKQVQDQTEKELFESYIEG  365
               SCOP domains d1ycp.2 J:,K:,M: Thrombin     SCOP domains
               CATH domains 1ycpJ00 J:1B-14M              CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author ..................hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------------- PROSITE (1)
                PROSITE (2) ----------------------------- PROSITE (2)
           Transcript 1 (1) 1.--------------------------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.9  PDB: J:1A-14M      Transcript 1 (2)
                1ycp J   1B ADCGLRPLFEKKQVQDQTEKELFESYIEG  14M
                            ||       8      |14D|||||||||
                           1B|            14A||||||14J|||
                            1A             14B||||||14K||
                                            14C||||||14L|
                                             14D||||| 14M
                                              14E||||    
                                               14F|||    
                                                14G||    
                                                 14H|    
                                                  14I    

Chain K from PDB  Type:PROTEIN  Length:146
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:146
                                   376       386       396       406       416       426       436       446       456       466       476       486       496       506      
          THRB_BOVIN    367 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRE  512
               SCOP domains d1ycp.2 J:,K:,M: Thrombin                                                                                                                          SCOP domains
               CATH domains 1ycpK00 K:16-146 Trypsin-like serine proteases                                                                                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............eeeeee....eeeeeee.....eeee.hhhh..hhh.....hhheeee..................eeeeee..............eeeee.................hhhhhhh................. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: K:16-146 UniProt: 367-621                                                                                                        PROSITE (1)
                PROSITE (2) --------------------------------------TRYPSI------------------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) -------------Exon 1.10  PDB: K:29-75 UniProt: 380-436                 ---------------------------------------------------------Exon 1.12           Transcript 1 (1)
           Transcript 1 (2) Exon 1.9      -------------------------------------------------------Exon 1.11  PDB: K:75-129B UniProt: 436-494                 ------------------ Transcript 1 (2)
                1ycp K   16 IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRE  146
                                    25        35 |      44        54      |60D|||||   65        75  |     84        94   |   103       113       123      |130       140      
                                               36A                      60A||||||||               77A                  97A                             129A||                 
                                                                         60B|||||||                                                                     129B|                 
                                                                          60C||||||                                                                      129C                 
                                                                           60D|||||                                                                                           
                                                                            60E||||                                                                                           
                                                                             60F|||                                                                                           
                                                                              60G||                                                                                           
                                                                               60H|                                                                                           
                                                                                60I                                                                                           

Chain L from PDB  Type:PROTEIN  Length:29
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:29
                                   346       356         
          THRB_BOVIN    337 ADCGLRPLFEKKQVQDQTEKELFESYIEG  365
               SCOP domains d1ycp.1 L:,H: Thrombin        SCOP domains
               CATH domains 1ycpL00 L:1B-14M              CATH domains
           Pfam domains (1) Thrombin_light-1ycpL01        Pfam domains (1)
           Pfam domains (2) Thrombin_light-1ycpL02        Pfam domains (2)
         Sec.struct. author ..................hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------------- PROSITE (1)
                PROSITE (2) ----------------------------- PROSITE (2)
           Transcript 1 (1) 1.--------------------------- Transcript 1 (1)
           Transcript 1 (2) -Exon 1.9  PDB: L:1A-14M      Transcript 1 (2)
                1ycp L   1B ADCGLRPLFEKKQVQDQTEKELFESYIEG  14M
                            ||       8      |14D|||||||||
                           1B|            14A||||||14J|||
                            1A             14B||||||14K||
                                            14C||||||14L|
                                             14D||||| 14M
                                              14E||||    
                                               14F|||    
                                                14G||    
                                                 14H|    
                                                  14I    

Chain M from PDB  Type:PROTEIN  Length:101
 aligned with THRB_BOVIN | P00735 from UniProtKB/Swiss-Prot  Length:625

    Alignment length:101
                                   530       540       550       560       570       580       590       600       610       620 
          THRB_BOVIN    521 VQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID  621
               SCOP domains d1ycp.2 J:,K:,M: Thrombin                                                                             SCOP domains
               CATH domains 1ycpM00 M:150-243 Trypsin-like serine proteases                                                       CATH domains
           Pfam domains (1) Trypsin-1ycpM01 M:150-238                                                                       ----- Pfam domains (1)
           Pfam domains (2) Trypsin-1ycpM02 M:150-238                                                                       ----- Pfam domains (2)
           Pfam domains (3) Trypsin-1ycpM03 M:150-238                                                                       ----- Pfam domains (3)
         Sec.struct. author ...............hhhhhhh........eeee...hhh.............eeeeee....eeeeeeeeee..........eeeee....hhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------N--------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: - UniProt: 367-621                                                                  PROSITE (1)
                PROSITE (2) --------------------------------------------TRYPSIN_SER --------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.12  PDB: M:150-184          -----------------------Exon 1.14  PDB: M:203-243 (gaps)            Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.13  PDB: M:184-20------------------------------------------- Transcript 1 (2)
                1ycp M  150 VQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID  243
                                   159       169       179     |186B||     194       204||     212    || 222       232       242 
                                                            184A  ||||               204A|          217|  |                      
                                                               186A|||                204B           219  |                      
                                                                186B||                                 221A                      
                                                                 186C|                                                           
                                                                  186D                                                           

Chain N from PDB  Type:PROTEIN  Length:6
 aligned with FIBA_HUMAN | P02671 from UniProtKB/Swiss-Prot  Length:866

    Alignment length:11
                                    36 
          FIBA_HUMAN     27 FLAEGGGVRGP   37
               SCOP domains ----------- SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .-----..... Sec.struct. author
             SAPs(SNPs) (1) --------C-L SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------H-- SAPs(SNPs) (2)
                    PROSITE ----------- PROSITE
               Transcript 2 Exon 2.2    Transcript 2
                1ycp N  308 Y-----GVRGP  318
                            |     |317 
                          308   314    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
2a1ycpH02H:28-120,H:233-242
2b1ycpH01H:16-27,H:121-232
2c1ycpM00M:150-243
2d1ycpK00K:16-146

(-) Pfam Domains  (2, 5)

Asymmetric Unit
(-)
Family: Trypsin (679)
1aTrypsin-1ycpM01M:150-238
1bTrypsin-1ycpM02M:150-238
1cTrypsin-1ycpM03M:150-238

(-) Gene Ontology  (86, 98)

Asymmetric Unit(hide GO term definitions)
Chain F,N   (FIBA_HUMAN | P02671)
molecular function
    GO:0050839    cell adhesion molecule binding    Interacting selectively and non-covalently with a cell adhesion molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0030674    protein binding, bridging    The binding activity of a molecule that brings together two or more protein molecules, or a protein and another macromolecule or complex, through a selective, non-covalent, often stoichiometric interaction, permitting those molecules to function in a coordinated way.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0006953    acute-phase response    An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0072377    blood coagulation, common pathway    A protein activation cascade that contributes to blood coagulation and consists of events leading from the formation of activated factor X to the formation of active thrombin, the cleavage of fibrinogen by thrombin, and the formation of cleaved fibrin into a stable multimeric, cross-linked complex.
    GO:0072378    blood coagulation, fibrin clot formation    A protein activation cascade that contributes to blood coagulation and consists of the cascade of enzymatic reactions initiated by physical damage to the wall of a blood vessel, leading to the formation of a formation of a fibrin clot at the site of the injury. The process also includes numerous positive and negative regulatory events.
    GO:0007160    cell-matrix adhesion    The binding of a cell to the extracellular matrix via adhesion molecules.
    GO:0043623    cellular protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex, occurring at the level of an individual cell.
    GO:0044267    cellular protein metabolic process    The chemical reactions and pathways involving a specific protein, rather than of proteins in general, occurring at the level of an individual cell. Includes cellular protein modification.
    GO:0071345    cellular response to cytokine stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:1990643    cellular response to granulocyte colony-stimulating factor    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a granulocyte colony-stimulating factor stimulus.
    GO:0071354    cellular response to interleukin-6    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-6 stimulus.
    GO:0071407    cellular response to organic cyclic compound    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0030198    extracellular matrix organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0043152    induction of bacterial agglutination    Any process in which infecting bacteria are clumped together by a host organism.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0097421    liver regeneration    The regrowth of lost or destroyed liver.
    GO:2000261    negative regulation of blood coagulation, common pathway    Any process that stops, prevents or reduces the frequency, rate or extent of blood coagulation, common pathway.
    GO:2000352    negative regulation of endothelial cell apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
    GO:1902042    negative regulation of extrinsic apoptotic signaling pathway via death domain receptors    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
    GO:0031639    plasminogen activation    The process in which inactive plasminogen is processed to active plasmin. This process includes cleavage at an internal Arg-Val site to form an N-terminal A-chain and C-terminal B-chain held together by a disulfide bond, and can include further proteolytic cleavage events to remove the preactivation peptide.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0070527    platelet aggregation    The adhesion of one platelet to one or more other platelets via adhesion molecules.
    GO:0002576    platelet degranulation    The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0045921    positive regulation of exocytosis    Any process that activates or increases the frequency, rate or extent of exocytosis.
    GO:0034116    positive regulation of heterotypic cell-cell adhesion    Any process that activates or increases the frequency, rate, or extent of heterotypic cell-cell adhesion.
    GO:0090277    positive regulation of peptide hormone secretion    Any process that increases the rate, frequency, or extent of the regulated release of a peptide hormone from secretory granules.
    GO:0050714    positive regulation of protein secretion    Any process that activates or increases the frequency, rate or extent of the controlled release of a protein from a cell.
    GO:1900026    positive regulation of substrate adhesion-dependent cell spreading    Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    GO:0045907    positive regulation of vasoconstriction    Any process that activates or increases the frequency, rate or extent of vasoconstriction.
    GO:0006461    protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
    GO:0051592    response to calcium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0046898    response to cycloheximide    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cycloheximide stimulus. Cycloheximide (actidione) is an antibiotic produced by some Streptomyces species which interferes with protein synthesis in eukaryotes.
    GO:0032355    response to estradiol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0033595    response to genistein    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a genistein stimulus.
    GO:0043278    response to morphine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a morphine stimulus. Morphine is an opioid alkaloid, isolated from opium, with a complex ring structure.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:1903561    extracellular vesicle    Any vesicle that is part of the extracellular region.
    GO:0005577    fibrinogen complex    A highly soluble, elongated protein complex found in blood plasma and involved in clot formation. It is converted into fibrin monomer by the action of thrombin. In the mouse, fibrinogen is a hexamer, 46 nm long and 9 nm maximal diameter, containing two sets of nonidentical chains (alpha, beta, and gamma) linked together by disulfide bonds.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0031091    platelet alpha granule    A secretory organelle found in blood platelets, which is unique in that it exhibits further compartmentalization and acquires its protein content via two distinct mechanisms: (1) biosynthesis predominantly at the megakaryocyte (MK) level (with some vestigial platelet synthesis) (e.g. platelet factor 4) and (2) endocytosis and pinocytosis at both the MK and circulating platelet levels (e.g. fibrinogen (Fg) and IgG).
    GO:0031093    platelet alpha granule lumen    The volume enclosed by the membrane of the platelet alpha granule.
    GO:0005791    rough endoplasmic reticulum    The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.

Chain H,J,K,L,M   (THRB_BOVIN | P00735)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0070051    fibrinogen binding    Interacting selectively and non-covalently with fibrinogen, a highly soluble hexameric glycoprotein complex that is found in blood plasma and is converted to fibrin by thrombin in the coagulation cascade.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0070053    thrombospondin receptor activity    Combining with thrombospondin and transmitting the signal to initiate a change in cell activity.
biological process
    GO:0006953    acute-phase response    An acute inflammatory response that involves non-antibody proteins whose concentrations in the plasma increase in response to infection or injury of homeothermic animals.
    GO:0007596    blood coagulation    The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0042730    fibrinolysis    A process that solubilizes fibrin in the bloodstream of a multicellular organism, chiefly by the proteolytic action of plasmin.
    GO:0007599    hemostasis    The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
    GO:0048712    negative regulation of astrocyte differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of astrocyte differentiation.
    GO:0045861    negative regulation of proteolysis    Any process that stops, prevents, or reduces the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
    GO:0030168    platelet activation    A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
    GO:0030194    positive regulation of blood coagulation    Any process that activates or increases the frequency, rate or extent of blood coagulation.
    GO:0030307    positive regulation of cell growth    Any process that activates or increases the frequency, rate, extent or direction of cell growth.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0032967    positive regulation of collagen biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:1900738    positive regulation of phospholipase C-activating G-protein coupled receptor signaling pathway    Any process that activates or increases the frequency, rate or extent of phospholipase C-activating G-protein coupled receptor signaling pathway.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:2000379    positive regulation of reactive oxygen species metabolic process    Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
    GO:0051281    positive regulation of release of sequestered calcium ion into cytosol    Any process that activates or increases the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
    GO:0051258    protein polymerization    The process of creating protein polymers, compounds composed of a large number of component monomers; polymeric proteins may be made up of different or identical monomers. Polymerization occurs by the addition of extra monomers to an existing poly- or oligomeric protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0008360    regulation of cell shape    Any process that modulates the surface configuration of a cell.
    GO:0051480    regulation of cytosolic calcium ion concentration    Any process involved in the maintenance of an internal steady state of calcium ions within the cytosol of a cell or between the cytosol and its surroundings.
    GO:0010468    regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
cellular component
    GO:0072562    blood microparticle    A phospholipid microvesicle that is derived from any of several cell types, such as platelets, blood cells, endothelial cells, or others, and contains membrane receptors as well as other proteins characteristic of the parental cell. Microparticles are heterogeneous in size, and are characterized as microvesicles free of nucleic acids.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ycp)
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser H:36A - Pro H:37   [ RasMol ]  
    Ser K:36A - Pro K:37   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ycp
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FIBA_HUMAN | P02671
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  THRB_BOVIN | P00735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.5
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  616004
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FIBA_HUMAN | P02671
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  THRB_BOVIN | P00735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FIBA_HUMAN | P026711bbr 1dm4 1fph 1fza 1fzb 1fzc 1fzd 1fze 1fzf 1fzg 1lt9 1ltj 1n86 1n8e 1re3 1re4 1rf0 1rf1 2a45 2ffd 2h43 2hlo 2hod 2hpc 2oyh 2oyi 2q9i 2xnx 2xny 2z4e 3at0 3bvh 3e1i 3ghg 3h32 3hus 4f27 5cfa
        THRB_BOVIN | P007351a0h 1avg 1bbr 1etr 1ets 1ett 1hrt 1id5 1mkw 1mkx 1nl1 1nl2 1tbq 1tbr 1toc 1ucy 1uvt 1uvu 1vit 2a1d 2hpp 2ody 2pf1 2pf2 2spt 3pma 3pmb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1YCP)