3HU6 - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:284
 aligned with SPOP_HUMAN | O43791 from UniProtKB/Swiss-Prot  Length:374

    Alignment length:303
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326   
           SPOP_HUMAN    27 IKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHA 329
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeee.hhhh.......ee......----..eeeeeee.....--...eeeeeeeeee...-.eeeeeeeeee.....eeeeee....eee....eeeeeeeeehhhhhh.....hhh.eeeeeeeeeeee..-----.-..........hhhhhhhhhhhhh....eeeee..eeeeehhhhhhhhhhhhhhhhhh------..eeee...hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh.....hhhhhhhhhhhh.hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----MATH  PDB: A:31-161 UniProt: 31-161                                                                                                --------------------------------------BTB  PDB: A:200-262 UniProt: 200-262                           ------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.10d  PDB: A:27-67 (gaps)          --------------------------------------------------Exon 1.13b  PDB: A:118-160 UniProt: 118-160Exon 1.16c  PDB: A:161-220 (gaps) UniProt: 161-220          ------------------Exon 1.18b  PDB: A:239-279               Exon 1.19b  PDB: A:280-327 UniProt: 280-327     -- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------Exon 1.12c  PDB: A:67-118 (gaps) UniProt: 67-118    -----------------------------------------------------------------------------------------------------Exon 1.17          ----------------------------------------------------------------------------------------1.2 Transcript 1 (2)
                 3hu6 A  27 SKVVKFSYMWTINNFSFCREEMGEVIKSSTFSS----KLKWCLRVNPKGLD--SKDYLSLYLLLVSCPK-EVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVVQDS-----Q-TMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEH------KNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHA 329
                                    36        46        56  |    |66        76|  |    86        |-|      106       116       126       136       146       156       166|     |176       186       196       206       216       226    |    - |     246       256       266       276       286       296       306       316       326   
                                                           59   64           77 80             95 |                                                                   167   173 |                                                     231    238                                                                                           
                                                                                                 97                                                                           175

Chain B from PDB  Type:PROTEIN  Length:282
 aligned with SPOP_HUMAN | O43791 from UniProtKB/Swiss-Prot  Length:374

    Alignment length:303
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326   
           SPOP_HUMAN    27 IKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHA 329
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeee............ee.......---..eeeeeee....hhhhh.eeeeeeeeee...-.eeeeeeeeee.-...eeeeee....eee....eeeeeeeeehhhhhhhhhh.hhh.eeeeeeeeeeee..----------.......hhhhhhhhhhhh.....eeeee..eeeeehhhhhhhhhhhhhhhhhh------..eeee...hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhhhhhh.hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----MATH  PDB: B:31-161 UniProt: 31-161                                                                                                --------------------------------------BTB  PDB: B:200-262 UniProt: 200-262                           ------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.10d  PDB: B:27-67 (gaps)          --------------------------------------------------Exon 1.13b  PDB: B:118-160 UniProt: 118-160Exon 1.16c  PDB: B:161-220 (gaps) UniProt: 161-220          ------------------Exon 1.18b  PDB: B:239-279               Exon 1.19b  PDB: B:280-327 UniProt: 280-327     -- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------Exon 1.12c  PDB: B:67-118 (gaps) UniProt: 67-118    -----------------------------------------------------------------------------------------------------Exon 1.17          ----------------------------------------------------------------------------------------1.2 Transcript 1 (2)
                 3hu6 B  27 SKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG---KLKWCLRVNPKGLDEESKDYLSLYLLLVSCPK-EVRAKFKFSILN-KGEETKAMESQRAYRFVQGKDWGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVVQDS----------MVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEH------KNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHA 329
                                    36        46        56   |   |66        76        86        |-|      106 | |   116       126       136       146       156       166|        - |     186       196       206       216       226    |    - |     246       256       266       276       286       296       306       316       326   
                                                            60  64                             95 |        108 |                                                      167        178                                                  231    238                                                                                           
                                                                                                 97          110

Chain C from PDB  Type:PROTEIN  Length:6
 aligned with Q9VHV8_DROME | Q9VHV8 from UniProtKB/TrEMBL  Length:476

    Alignment length:6
         Q9VHV8_DROME    97 EVTSTT 102
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 3hu6 C  97 EVTSTT 102

Chain D from PDB  Type:PROTEIN  Length:6
 aligned with Q9VHV8_DROME | Q9VHV8 from UniProtKB/TrEMBL  Length:476

    Alignment length:6
         Q9VHV8_DROME    97 EVTSTT 102
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 3hu6 D  97 EVTSTT 102

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (SPOP_HUMAN | O43791)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
cellular component
	GO:0031463	Cul3-RING ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul3 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a BTB-domain-containing protein.
	GO:0016607	nuclear speck	A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,D (Q9VHV8_DROME | Q9VHV8)

molecular function
	GO:0008579	JUN kinase phosphatase activity	Catalysis of the reaction: JUN kinase serine/threonine/tyrosine phosphate + H2O = JUN kinase serine/threonine/tyrosine + phosphate.
	GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	Catalysis of the reaction: MAP kinase serine/threonine/tyrosine phosphate + H2O = MAP kinase serine/threonine/tyrosine + phosphate.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0008138	protein tyrosine/serine/threonine phosphatase activity	Catalysis of the reactions: protein serine + H2O = protein serine + phosphate; protein threonine phosphate + H2O = protein threonine + phosphate; and protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0007254	JNK cascade	An intracellular protein kinase cascade containing at least a JNK (a MAPK), a JNKK (a MAPKK) and a JUN3K (a MAP3K). The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0007015	actin filament organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments. Includes processes that control the spatial distribution of actin filaments, such as organizing filaments into meshworks, bundles, or other structures, as by cross-linking.
	GO:0007298	border follicle cell migration	The directed movement of a border cell through the nurse cells to reach the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0034599	cellular response to oxidative stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0008362	chitin-based embryonic cuticle biosynthetic process	Synthesis, including the chemical reactions and pathways resulting in the formation of chitin and other components, and deposition of a chitin-based embryonic cuticle by the underlying epidermal epithelium. This tough, waterproof cuticle layer is essential to provide structural integrity of the larval body. An example of this is found in Drosophila melanogaster.
	GO:0048749	compound eye development	The process whose specific outcome is the progression of the compound eye over time, from its formation to the mature structure. The compound eye is an organ of sight that contains multiple repeating units, often arranged hexagonally. Each unit has its own lens and photoreceptor cell(s) and can generate either a single pixelated image or multiple images, per eye.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0008340	determination of adult lifespan	The control of viability and duration in the adult phase of the life-cycle.
	GO:0071907	determination of digestive tract left/right asymmetry	Determination of the asymmetric location of various parts of the digestive tract with respect to the left and right halves of the organism. The digestive tract is the anatomical structure through which food passes and is processed.
	GO:0046843	dorsal appendage formation	Establishment of the dorsal filaments, elaborate specializations of the chorion that protrude from the anterior end of the egg and facilitate embryonic respiration.
	GO:0007391	dorsal closure	The process during Drosophila embryogenesis whereby the ectodermal cells of the lateral epithelium stretch in a coordinated fashion to internalize the amnioserosa cells and close the embryo dorsally.
	GO:0048615	embryonic anterior midgut (ectodermal) morphogenesis	The process in which the anatomical structures of the anterior midgut (ectodermal) are generated and organized, during the embryonic phase.
	GO:0008544	epidermis development	The process whose specific outcome is the progression of the epidermis over time, from its formation to the mature structure. The epidermis is the outer epithelial layer of an animal, it may be a single layer that produces an extracellular material (e.g. the cuticle of arthropods) or a complex stratified squamous epithelium, as in the case of many vertebrate species.
	GO:0001736	establishment of planar polarity	Coordinated organization of groups of cells in the plane of an epithelium, such that they all orient to similar coordinates.
	GO:0007561	imaginal disc eversion	The eversion (turning inside out) of imaginal discs from their peripodial sacs, resulting in movement of the epithelium to the outside of the larval epidermis.
	GO:0046528	imaginal disc fusion	The process following disc eversion whereby imaginal discs fuse with adjacent disc derivatives to form a continuous adult epidermis.
	GO:0046529	imaginal disc fusion, thorax closure	The joining of the parts of the wing imaginal discs, giving rise to the adult thorax.
	GO:0000188	inactivation of MAPK activity	Any process that terminates the activity of the active enzyme MAP kinase.
	GO:0046844	micropyle formation	Establishment of the micropyle, a single cone-shaped specialization of the chorion that allows sperm entry into the egg prior to fertilization.
	GO:0046329	negative regulation of JNK cascade	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the JNK cascade.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0070303	negative regulation of stress-activated protein kinase signaling cascade	Any process that stops, prevents, or reduces the frequency, rate or extent of signaling via the stress-activated protein kinase signaling cascade.
	GO:0016318	ommatidial rotation	The process in which photoreceptors are arranged in ommatidia in the dorsal and ventral fields to be mirror images. The polarity is established in the imaginal discs concurrently with cell fate specification.
	GO:0030707	ovarian follicle cell development	The process that occurs during oogenesis involving the ovarian follicle cells, somatic cells which surround the germ cells of an ovary. An example of this is found in Drosophila melanogaster.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0007422	peripheral nervous system development	The process whose specific outcome is the progression of the peripheral nervous system over time, from its formation to the mature structure. The peripheral nervous system is one of the two major divisions of the nervous system. Nerves in the PNS connect the central nervous system (CNS) with sensory organs, other organs, muscles, blood vessels and glands.
	GO:0050778	positive regulation of immune response	Any process that activates or increases the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0009306	protein secretion	The controlled release of proteins from a cell.
	GO:0010389	regulation of G2/M transition of mitotic cell cycle	Any process that modulates the rate or extent of progression from G2 phase to M phase of the mitotic cell cycle.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0006979	response to oxidative stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0007396	suture of dorsal opening	Closure of the dorsal hole. Filopodia extending from each leading edge interdigitate at the dorsal midline and appear to prime the formation of adherens junctions between the two rows of leading edge cells. Newly formed septate junctions are also used to seal the dorsal hole.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (8, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (52, 52)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File