3HVE - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   STRUCTURES OF SPOP-SUBSTRATE COMPLEXES: INSIGHTS INTO MOLECULAR ARCHITECTURES OF BTB-CUL3 UBIQUITIN LIGASES: GIGAXONINBTB/3-BOX

Authors :   M. Zhuang, B. A. Schulman

Date :   16 Jun 09 (Deposition) - 27 Oct 09 (Release) - 27 Oct 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym./Biol. Unit : A,B

Keywords :   Ubiquitin, Gigaxonin, Cytoplasm, Cytoskeleton, Disease Mutation, Kelch Repeat, Neurodegeneration, Phosphoprotein, Polymorphism, Ubl Conjugation, Ubl Conjugation Pathway, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Zhuang, M. F. Calabrese, J. Liu, M. B. Waddell, A. Nourse, M. Hammel, D. J. Miller, H. Walden, D. M. Duda, S. N. Seyedin, T. Hoggard, J. W. Harper, K. P. White, B. A. Schulman
Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases.
Mol. Cell V. 36 39 2009
PubMed-ID: 19818708 | Reference-DOI: 10.1016/J.MOLCEL.2009.09.022
(for further references see the PDB file header)

Molecule 1 - GIGAXONIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 1-254
	Gene	:	GAN, GAN1, KLHL16
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	KELCH-LIKE PROTEIN 16

Molecule 2 - GIGAXONIN
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 1-254
	Gene	:	GAN, GAN1, KLHL16
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	KELCH-LIKE PROTEIN 16

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 45)

No.	Name	Count	Type	Full Name
1	MSE	10	Mod. Amino Acid	SELENOMETHIONINE
2	UNK	35	Mod. Amino Acid

(no "Site" information available for 3HVE)

(no "SS Bond" information available for 3HVE)

(no "Cis Peptide Bond" information available for 3HVE)

Asymmetric/Biological Unit (10, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_010759	R	15	S	GAN_HUMAN	Disease (GAN1)	119485093	A/B	R	15	S
02	UniProt	VAR_054113	A	51	P	GAN_HUMAN	Disease (GAN1)	750258209	A/B	A	51	P
03	UniProt	VAR_010760	S	52	G	GAN_HUMAN	Disease (GAN1)	---	A/B	S	52	G
04	UniProt	VAR_010761	S	79	L	GAN_HUMAN	Disease (GAN1)	---	A/B	S	79	L
05	UniProt	VAR_010762	V	82	F	GAN_HUMAN	Disease (GAN1)	---	A/B	V	82	F
06	UniProt	VAR_015680	I	86	F	GAN_HUMAN	Disease (GAN1)	---	A/B	I	86	F
07	UniProt	VAR_054114	Y	89	C	GAN_HUMAN	Disease (GAN1)	---	A/B	Y	89	C
08	UniProt	VAR_073289	I	102	T	GAN_HUMAN	Disease	---	A/B	I	102	T
09	UniProt	VAR_010763	R	138	H	GAN_HUMAN	Disease (GAN1)	119485092	A/B	R	138	H
10	UniProt	VAR_054115	V	195	F	GAN_HUMAN	Disease (GAN1)	---	A/B	X	195	F

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BTB	PS50097	BTB domain profile.	GAN_HUMAN	30-99	2	A:30-98 B:30-99

(no "Exon" information available for 3HVE)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:216
 aligned with GAN_HUMAN | Q9H2C0 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:240
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247
            GAN_HUMAN     8 SDPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNEDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDTEIRKVHMKDVMSALWVSGLDSSYLREQMLNEPLVREIVKE 247
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhh...--....eeeee..eeeeehhhhhhh.hhhhhhh.-----------.eee....hhhhhhhhhhhhhhh.....-.hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.hhhhhh.hhhhhhhhhhh.-------..hhhhhh.....--.....hhhhhhhhhhhhh..-.hhhhhhhh..hhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------S-----------------------------------PG--------------------------L--F---F--C------------T-----------------------------------H------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------BTB  PDB: A:30-98 UniProt: 30-99                                      ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hve A   8 SDPQHAARLLRALSSFRE--RFCDAHLVLDGEEIPVQKNILAAASPYIRTKL-----------YKIELEGISVmVmREILDYIFSGQIRLN-DTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLE-------RYVFEAVIRWIAH--EIRKVHmKDVmSALWVSGLD-SYLREQmLNEPLVREIVKE 247
                                    17       | -|       37        47        57 |       -   |    77   | |  87        97| |    107       117       127       137       147       157       167       177       | -     | 197       | -|     |217|      227 |     237       247
                                            25 28                             59          71        81-MSE           98 |                                                                                  185     193         205  |     |   |      227 |     |            
                                                                                                      83-MSE          100                                                                                                         208     |   |        229     |            
                                                                                                                                                                                                                                        214-MSE              235-MSE        
                                                                                                                                                                                                                                            218-MSE

Chain B from PDB  Type:PROTEIN  Length:195
 aligned with GAN_HUMAN | Q9H2C0 from UniProtKB/Swiss-Prot  Length:597

    Alignment length:231
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238 
            GAN_HUMAN     9 DPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNEDTIQDVVQAADLLLLTDLKTLCCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKEVISLEKLNVGNERYVFEAVIRWIAHDTEIRKVHMKDVMSALWVSGLDSSYLREQMLNEP 239
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh...--.....ee.----.-..hhhhhhhhhhhhhhh.-----------.ee.....hhhhhhhhhhhhhhh....-..-..hhhhhhhhhhhhhhhhhhhhhhhh...--.hhhhhhhhhhh..-......................................------..............-----..hhhhhhhhhhhhh--hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------S-----------------------------------PG--------------------------L--F---F--C------------T-----------------------------------H--------------------------------------------------------F-------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------BTB  PDB: B:30-99 UniProt: 30-99                                      -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hve B   9 DPQHAARLLRALSSFRE--RFCDAHLV----E-PVQKNILAAASPYIRTKL-----------YKIELEGISVmVmREILDYIFSGQIRL-ED-IQDVVQAADLLLLTDLKTLCCEFLEGCIA--NCIGIRDFALHYCL-HVHYLATEYLETHFRDVxxxxxxxxxxxxxxxxxxxxx------xxxxxxxxxxxxxx-----KVHmKDVmSALWVSG--SSYLREQmLNEP 239
                                    18      | 28      |  - | |    48        58|        -  |     78  | |   88        |-|| |   108       118       128 |  |  138       148       158      |168|||||||178|||||||  -   ||||198|||||||  -  |  | 218      |228      |238 
                                           25 28     35   40 |               59          71        81-MSE          97 || |                         130  |          146 |              165-UNK||174-UNK||183-UNK    ||||198-UNK|||   211  |   |    225  |      |    
                                                            42                                       83-MSE          99| |                            133            148               166-UNK||175-UNK||184-UNK   |||||199-UNK||      214-MSE       228      |    
                                                                                                                     100 |                                                              167-UNK||176-UNK||185-UNK  ||||||200-UNK|          218-MSE          235-MSE
                                                                                                                       102                                                               168-UNK| 177-UNK|       192-UNK| 201-UNK                                  
                                                                                                                                                                                          169-UNK  178-UNK        193-UNK  202-UNK                                 
                                                                                                                                                                                           170-UNK  179-UNK        194-UNK  203-UNK                                
                                                                                                                                                                                            171-UNK  180-UNK        195-UNK  204-UNK                               
                                                                                                                                                                                             172-UNK  181-UNK        196-UNK  205-UNK                              
                                                                                                                                                                                              173-UNK  182-UNK        197-UNK

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3HVE)

(no "CATH Domain" information available for 3HVE)

(no "Pfam Domain" information available for 3HVE)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (GAN_HUMAN | Q9H2C0)

molecular function
	GO:0003674	molecular_function	Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
	GO:0007010	cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
cellular component
	GO:0031463	Cul3-RING ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul3 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a BTB-domain-containing protein.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UNK	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 3hve)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hve)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3hve
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GAN_HUMAN \| Q9H2C0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	256850
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GAN_HUMAN \| Q9H2C0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GAN_HUMAN \| Q9H2C0	:	2ppi

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 45)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 20)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File