Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF N-TERMINAL DOMAIN OF SPECKLE-TYPE POZ PROTEIN
 
Authors :  T. Nagashima, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  20 May 05  (Deposition) - 20 Nov 05  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Math Domain, Beta Sandwich, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Nagashima, F. Hayashi, S. Yokoyama
Solution Structure Of N-Terminal Domain Of Speckle-Type Poz Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SPECKLE-TYPE POZ PROTEIN
    ChainsA
    EngineeredYES
    Expression System PlasmidP040322-96
    Expression System Vector TypePLASMID
    FragmentMATH DOMAIN
    GeneSPOP
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2CR2)

(-) Sites  (0, 0)

(no "Site" information available for 2CR2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CR2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CR2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CR2)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MATHPS50144 MATH/TRAF domain profile.SPOP_HUMAN31-161  1A:11-141

(-) Exons   (5, 5)

NMR Structure (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1dENST000003933281dENSE00002053260chr17:47755472-47755295178SPOP_HUMAN-00--
1.2ENST000003933282ENSE00002056951chr17:47753378-47753257122SPOP_HUMAN-00--
1.8dENST000003933288dENSE00002153086chr17:47700238-47700095144SPOP_HUMAN1-26261A:1-77
1.10dENST0000039332810dENSE00002189108chr17:47699429-47699308122SPOP_HUMAN27-67411A:8-4740
1.12cENST0000039332812cENSE00002169279chr17:47696747-47696596152SPOP_HUMAN67-118521A:47-9852
1.13bENST0000039332813bENSE00001746781chr17:47696470-47696343128SPOP_HUMAN118-160431A:98-14043
1.16cENST0000039332816cENSE00000819785chr17:47688819-47688642178SPOP_HUMAN161-220601A:141-159 (gaps)32
1.17ENST0000039332817ENSE00002159579chr17:47685291-4768523656SPOP_HUMAN220-238190--
1.18bENST0000039332818bENSE00000819783chr17:47684734-47684612123SPOP_HUMAN239-279410--
1.19bENST0000039332819bENSE00000736281chr17:47679369-47679227143SPOP_HUMAN280-327480--
1.20gENST0000039332820gENSE00002070429chr17:47677884-476762461639SPOP_HUMAN327-374480--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:159
 aligned with SPOP_HUMAN | O43791 from UniProtKB/Swiss-Prot  Length:374

    Alignment length:180
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192
           SPOP_HUMAN    13 MSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGG 192
               SCOP domains ---------------d2cr2a1 A:8-153 Speckle-type poz protein SPOP                                                                                                     ------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......--------.eeeeeeeeeee.hhhh.......ee..............eeee..............eeee.......eeeee.eeeee.....eeeeee....eeee...eeee....hhhhhh..........eeeeeeeeeee.........-------------...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------MATH  PDB: A:11-141 UniProt: 31-161                                                                                                ------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8d     Exon 1.10d  PDB: A:8-47 UniProt: 27-67   --------------------------------------------------Exon 1.13b  PDB: A:98-140 UniProt: 118-160 Exon 1.16c  PDB: A:141-159 (gaps Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.12c  PDB: A:47-98 UniProt: 67-118            -------------------------------------------------------------------------- Transcript 1 (2)
                 2cr2 A   1 GSSGSSG--------KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQ-------------SGPSSG 159
                                  |  -     |  12        22        32        42        52        62        72        82        92       102       112       122       132       142       152|        -    |  159
                                  7        8                                                                                                                                              153           154     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CR2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CR2)

(-) Gene Ontology  (8, 8)

NMR Structure(hide GO term definitions)
Chain A   (SPOP_HUMAN | O43791)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0043161    proteasome-mediated ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
cellular component
    GO:0031463    Cul3-RING ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul3 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a BTB-domain-containing protein.
    GO:0016607    nuclear speck    A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2cr2)
 
  Sites
(no "Sites" information available for 2cr2)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cr2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cr2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SPOP_HUMAN | O43791
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SPOP_HUMAN | O43791
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SPOP_HUMAN | O437913hqh 3hqi 3hql 3hqm 3hsv 3htm 3hu6 3ivb 3ivq 3ivv 4eoz 4hs2 4j8z 4o1v

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CR2)