3GFT - JenaLib

Asymmetric Unit (43, 231)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	A/B/C/D/E/F	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	A/B/C/D/E/F	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	A/B/C/D/E/F	G	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	A/B/C/D/E/F	G	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	A/B/C/D/E/F	G	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	A/B/C/D/E/F	G	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	A/B/C/D/E/F	G	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	A/B/C/D/E/F	G	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	A/B/C/D/E/F	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	A/B/C/D/E/F	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	A/B/C/D/E/F	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	A/B/C/D/E/F	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	A/B/C/D/E/F	Q	22	R
26	UniProt	VAR_064852	P	34	L	RASK_HUMAN	Disease (NS3)	104894366	A/B/C/E	P	34	L
27	UniProt	VAR_064853	P	34	Q	RASK_HUMAN	Disease (NS3)	---	A/B/C/E	P	34	Q
28	UniProt	VAR_026110	P	34	R	RASK_HUMAN	Disease (CFC2)	104894366	A/B/C/E	P	34	R
29	UniProt	VAR_064854	I	36	M	RASK_HUMAN	Disease (NS3)	727503109	A/B/E	I	36	M
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	A/B/C/D/E/F	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	A/B/C/D/E/F	A	59	T
32	UniProt	VAR_026112	G	60	R	RASK_HUMAN	Disease (CFC2)	104894359	A/B/C/D/E	G	60	R
33	UniProt	VAR_065146	G	60	S	RASK_HUMAN	Disease (NS3)	104894359	A/B/C/D/E	G	60	S
34	UniProt	VAR_006841	Q	61	H	RASK_HUMAN	Unclassified	17851045	A	H	61	H
35	UniProt	VAR_036306	Q	61	R	RASK_HUMAN	Unclassified	121913240	A	H	61	R
36	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_13 *	Q	61	R	RASK_HUMAN	Disease (Colorectal cancer)	---	A	H	61	R
37	UniProt	VAR_069784	Y	71	H	RASK_HUMAN	Disease (CFC2)	387907205	A/B/C/E/F	Y	71	H
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	A/B/C/D/E/F	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	A/B/C/D/E/F	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	A/B/C/D/E/F	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	A/B/C/D/E/F	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (43, 43)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	A	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	A	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	A	G	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	A	G	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	A	G	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	A	G	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	A	G	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	A	G	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	A	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	A	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	A	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	A	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	A	Q	22	R
26	UniProt	VAR_064852	P	34	L	RASK_HUMAN	Disease (NS3)	104894366	A	P	34	L
27	UniProt	VAR_064853	P	34	Q	RASK_HUMAN	Disease (NS3)	---	A	P	34	Q
28	UniProt	VAR_026110	P	34	R	RASK_HUMAN	Disease (CFC2)	104894366	A	P	34	R
29	UniProt	VAR_064854	I	36	M	RASK_HUMAN	Disease (NS3)	727503109	A	I	36	M
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	A	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	A	A	59	T
32	UniProt	VAR_026112	G	60	R	RASK_HUMAN	Disease (CFC2)	104894359	A	G	60	R
33	UniProt	VAR_065146	G	60	S	RASK_HUMAN	Disease (NS3)	104894359	A	G	60	S
34	UniProt	VAR_006841	Q	61	H	RASK_HUMAN	Unclassified	17851045	A	H	61	H
35	UniProt	VAR_036306	Q	61	R	RASK_HUMAN	Unclassified	121913240	A	H	61	R
36	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_13 *	Q	61	R	RASK_HUMAN	Disease (Colorectal cancer)	---	A	H	61	R
37	UniProt	VAR_069784	Y	71	H	RASK_HUMAN	Disease (CFC2)	387907205	A	Y	71	H
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	A	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	A	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	A	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	A	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	A	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	A	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (40, 40)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	B	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	B	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	B	G	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	B	G	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	B	G	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	B	G	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	B	G	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	B	G	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	B	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	B	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	B	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	B	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	B	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	B	Q	22	R
26	UniProt	VAR_064852	P	34	L	RASK_HUMAN	Disease (NS3)	104894366	B	P	34	L
27	UniProt	VAR_064853	P	34	Q	RASK_HUMAN	Disease (NS3)	---	B	P	34	Q
28	UniProt	VAR_026110	P	34	R	RASK_HUMAN	Disease (CFC2)	104894366	B	P	34	R
29	UniProt	VAR_064854	I	36	M	RASK_HUMAN	Disease (NS3)	727503109	B	I	36	M
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	B	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	B	A	59	T
32	UniProt	VAR_026112	G	60	R	RASK_HUMAN	Disease (CFC2)	104894359	B	G	60	R
33	UniProt	VAR_065146	G	60	S	RASK_HUMAN	Disease (NS3)	104894359	B	G	60	S
37	UniProt	VAR_069784	Y	71	H	RASK_HUMAN	Disease (CFC2)	387907205	B	Y	71	H
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	B	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	B	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	B	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	B	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	B	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	B	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (39, 39)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	C	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	C	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	C	G	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	C	G	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	C	G	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	C	G	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	C	G	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	C	G	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	C	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	C	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	C	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	C	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	C	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	C	Q	22	R
26	UniProt	VAR_064852	P	34	L	RASK_HUMAN	Disease (NS3)	104894366	C	P	34	L
27	UniProt	VAR_064853	P	34	Q	RASK_HUMAN	Disease (NS3)	---	C	P	34	Q
28	UniProt	VAR_026110	P	34	R	RASK_HUMAN	Disease (CFC2)	104894366	C	P	34	R
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	C	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	C	A	59	T
32	UniProt	VAR_026112	G	60	R	RASK_HUMAN	Disease (CFC2)	104894359	C	G	60	R
33	UniProt	VAR_065146	G	60	S	RASK_HUMAN	Disease (NS3)	104894359	C	G	60	S
37	UniProt	VAR_069784	Y	71	H	RASK_HUMAN	Disease (CFC2)	387907205	C	Y	71	H
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	C	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	C	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	C	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	C	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	C	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	C	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (35, 35)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	D	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	D	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	D	G	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	D	G	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	D	G	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	D	G	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	D	G	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	D	G	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	D	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	D	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	D	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	D	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	D	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	D	Q	22	R
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	D	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	D	A	59	T
32	UniProt	VAR_026112	G	60	R	RASK_HUMAN	Disease (CFC2)	104894359	D	G	60	R
33	UniProt	VAR_065146	G	60	S	RASK_HUMAN	Disease (NS3)	104894359	D	G	60	S
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	D	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	D	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	D	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	D	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	D	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	D	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (40, 40)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	E	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	E	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	E	G	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	E	G	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	E	G	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	E	G	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	E	G	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	E	G	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	E	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	E	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	E	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	E	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	E	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	E	Q	22	R
26	UniProt	VAR_064852	P	34	L	RASK_HUMAN	Disease (NS3)	104894366	E	P	34	L
27	UniProt	VAR_064853	P	34	Q	RASK_HUMAN	Disease (NS3)	---	E	P	34	Q
28	UniProt	VAR_026110	P	34	R	RASK_HUMAN	Disease (CFC2)	104894366	E	P	34	R
29	UniProt	VAR_064854	I	36	M	RASK_HUMAN	Disease (NS3)	727503109	E	I	36	M
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	E	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	E	A	59	T
32	UniProt	VAR_026112	G	60	R	RASK_HUMAN	Disease (CFC2)	104894359	E	G	60	R
33	UniProt	VAR_065146	G	60	S	RASK_HUMAN	Disease (NS3)	104894359	E	G	60	S
37	UniProt	VAR_069784	Y	71	H	RASK_HUMAN	Disease (CFC2)	387907205	E	Y	71	H
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	E	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	E	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	E	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	E	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	E	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	E	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (34, 34)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	F	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	F	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	F	G	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	F	G	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	F	G	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	F	G	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	F	G	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	F	G	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	F	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	F	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	F	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	F	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	F	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	F	Q	22	R
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	F	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	F	A	59	T
37	UniProt	VAR_069784	Y	71	H	RASK_HUMAN	Disease (CFC2)	387907205	F	Y	71	H
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	F	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	F	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	F	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	F	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	F	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	F	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 6)

Exons (4, 24)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:167
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:167
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       
           RASK_HUMAN     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYR 167
               SCOP domains d3gfta_ A: automated matches                                                                                                                                            SCOP domains
               CATH domains 3gftA00 A:1-167 P-loop containing nucleotide triphosphate hydrolases                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee....hhhhhhhhhhhh..........eeeeeeeeee..eeeeeeeeee......hhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeee.........hhhhhhhhhhhhh..eee.......hhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ----E------ADI-------E-----------L-M---------------------ITRH---------H---------------------------------------------N----------------------------TE-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----N------AD--------R-----------Q-------------------------SR-------------------------------------------------------N----------------------------T--------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------CD--------------------R--------------------------R------------------------------------------------------------------------------------T--------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------DD---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------DR---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) -----------R----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE RAS  PDB: A:1-164 UniProt: 1-189                                                                                                                                        PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:1-37 UniProt: 1-37 Exon 1.3  PDB: A:38-97 UniProt: 38-97                       -----------------------------------------------------Exon 1.5b         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:97-150 UniProt: 97-150               ----------------- Transcript 1 (2)
                 3gft A   1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK 167
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160

Chain B from PDB  Type:PROTEIN  Length:166
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:170
                               1                                                                                                                                                                      
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167
           RASK_HUMAN     - ---MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYR 167
               SCOP domains d3gftb_ B: automated matches                                                                                                                                               SCOP domains
               CATH domains 3gftB00 B:-2-167 P-loop containing nucleotide triphosphate hydr    olases                                                                                                  CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeee....hhhhhhhhhhhh..........eeeeeeeeee..eeeeeeeeee..----hhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeee.........hhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------E------ADI-------E-----------L-M---------------------ITR----------H---------------------------------------------N----------------------------TE-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------N------AD--------R-----------Q-------------------------S--------------------------------------------------------N----------------------------T--------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------CD--------------------R---------------------------------------------------------------------------------------------------------------T--------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------DD---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) --------------DR---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) --------------R----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) --------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) --------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE ---RAS  PDB: B:1-164 UniProt: 1-189                                                                                                                                        PROSITE
           Transcript 1 (1) ---Exon 1.2a  PDB: B:1-37 UniProt: 1-37 Exon 1.3  PDB: B:38-97 (gaps) UniProt: 38-97                -----------------------------------------------------Exon 1.5b         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------Exon 1.4  PDB: B:97-150 UniProt: 97-150               ----------------- Transcript 1 (2)
                 3gft B  -2 FQGMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG----SAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK 167
                                     7        17        27        37        47        57  |    |67        77        87        97       107       117       127       137       147       157       167
                                                                                         60   65

Chain C from PDB  Type:PROTEIN  Length:165
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:171
                                1                                                                                                                                                                      
                                |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166 
           RASK_HUMAN     - ----MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYR 167
               SCOP domains d3gftc_ C: automated matches                                                                                                                                                SCOP domains
               CATH domains 3gftC00 C:-3-167 P-loop containing nucl  eotide triphosphate hyd    rolases                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeee.....hhhhhhhhhhhh.........--.eeeeeeee..eeeeeeeee...----hhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeee.........hhhhhhhhhhhhh..eee.......hhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) --------E------ADI-------E-----------L-----------------------ITR----------H---------------------------------------------N----------------------------TE-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------N------AD--------R-----------Q-------------------------S--------------------------------------------------------N----------------------------T--------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------CD--------------------R---------------------------------------------------------------------------------------------------------------T--------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------DD---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ---------------DR---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) ---------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) ---------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) ---------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) ---------------R----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) ---------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) ---------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) ---------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) ---------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) ---------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) ---------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE ----RAS  PDB: C:1-164 UniProt: 1-189                                                                                                                                        PROSITE
           Transcript 1 (1) ----Exon 1.2a  PDB: C:1-35 UniProt: 1-37 Exon 1.3  PDB: C:38-97 (gaps) UniProt: 38-97                -----------------------------------------------------Exon 1.5b         Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------Exon 1.4  PDB: C:97-150 UniProt: 97-150               ----------------- Transcript 1 (2)
                 3gft C  -3 YFQGMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPT--DSYRKQVVIDGETCLLDILDTAG----SAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK 167
                                     6        16        26        |- |      46        56   |    66        76        86        96       106       116       126       136       146       156       166 
                                                                 35 38                    60   65

Chain D from PDB  Type:PROTEIN  Length:150
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:167
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       
           RASK_HUMAN     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYR 167
               SCOP domains d3gftd_ D: automated matches                                                                                                                                            SCOP domains
               CATH domains 3gftD00 D:1-167 P-loop containi      ng nucleotide triphosph           ate hydrolases                                                                                   CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....hhhhhhhhhhhh.....------.eeeeeeee..eeeeeeeee...-----------.....eeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeee.........hhhhhhhhhhhh...eee.......hhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ----E------ADI-------E-----------------------------------ITR--------------------------------------------------------N----------------------------TE-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----N------AD--------R-------------------------------------S--------------------------------------------------------N----------------------------T--------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------CD------------------------------------------------------------------------------------------------------------------------------------T--------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------DD---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------DR---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) -----------R----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE RAS  PDB: D:1-164 UniProt: 1-189                                                                                                                                        PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: D:1-31 UniProt: 1-37 Exon 1.3  PDB: D:38-97 (gaps) UniProt: 38-97                -----------------------------------------------------Exon 1.5b         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------Exon 1.4  PDB: D:97-150 UniProt: 97-150               ----------------- Transcript 1 (2)
                 3gft D   1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDE------DSYRKQVVIDGETCLLDILDTAG-----------MRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK 167
                                    10        20        30|      |40        50        60         - |      80        90       100       110       120       130       140       150       160       
                                                         31     38                    60          72

Chain E from PDB  Type:PROTEIN  Length:163
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:170
                               1                                                                                                                                                                      
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167
           RASK_HUMAN     - ---MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYR 167
               SCOP domains d3gfte_ E: automated matches                                                                                                                                               SCOP domains
               CATH domains 3gftE00 E:-2-167 P-loop containing nucleotide triphosphate hydr       olases                                                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeee.....hhhhhhhhhhhh..........eeeeeeeeee..eeeeeeeeee..-------.hhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhh......eeeeee.........hhhhhhhhhhhhh..eee.......hhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------E------ADI-------E-----------L-M---------------------ITR----------H---------------------------------------------N----------------------------TE-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------N------AD--------R-----------Q-------------------------S--------------------------------------------------------N----------------------------T--------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------CD--------------------R---------------------------------------------------------------------------------------------------------------T--------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------DD---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) --------------DR---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) --------------R----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) --------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) --------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE ---RAS  PDB: E:1-164 UniProt: 1-189                                                                                                                                        PROSITE
           Transcript 1 (1) ---Exon 1.2a  PDB: E:1-37 UniProt: 1-37 Exon 1.3  PDB: E:38-97 (gaps) UniProt: 38-97                -----------------------------------------------------Exon 1.5b         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------Exon 1.4  PDB: E:97-150 UniProt: 97-150               ----------------- Transcript 1 (2)
                 3gft E  -2 FQGMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG-------RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK 167
                                     7        17        27        37        47        57  |      -|       77        87        97       107       117       127       137       147       157       167
                                                                                         60      68

Chain F from PDB  Type:PROTEIN  Length:155
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:170
                               1                                                                                                                                                                      
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167
           RASK_HUMAN     - ---MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYR 167
               SCOP domains d3gftf_ F: automated matches                                                                                                                                               SCOP domains
               CATH domains 3gftF00 F:-2-167 P-loop containing       nucleotide triphospha         te hydrolases                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeee....hhhhhhhhhhhh.....------.eeeeeeee..eeeeeeeee..---------hhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhhh.....eeeeee.........hhhhhhhhhhhh...eee.......hhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) -------E------ADI-------E-----------------------------------IT-----------H---------------------------------------------N----------------------------TE-------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------N------AD--------R----------------------------------------------------------------------------------------------N----------------------------T--------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) --------------CD------------------------------------------------------------------------------------------------------------------------------------T--------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) --------------DD---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) --------------DR---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) --------------D----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) --------------R----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) --------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) --------------S----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) --------------V----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE ---RAS  PDB: F:1-164 UniProt: 1-189                                                                                                                                        PROSITE
           Transcript 1 (1) ---Exon 1.2a  PDB: F:1-31 UniProt: 1-37 Exon 1.3  PDB: F:38-97 (gaps) UniProt: 38-97                -----------------------------------------------------Exon 1.5b         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------Exon 1.4  PDB: F:97-150 UniProt: 97-150               ----------------- Transcript 1 (2)
                 3gft F  -2 FQGMTEYKLVVVGAGGVGKSALTIQLIQNHFVDE------DSYRKQVVIDGETCLLDILDTA---------DQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK 167
                                     7        17        27   |     -|       47        57 |       - |      77        87        97       107       117       127       137       147       157       167
                                                            31     38                   59        69

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (0, 0)

Gene Ontology (49, 49)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (RASK_HUMAN | P01116)

molecular function
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0019002	GMP binding	Interacting selectively and non-covalently with GMP, guanosine monophosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0030275	LRR domain binding	Interacting selectively and non-covalently with a LRR domain (leucine rich repeats) of a protein.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0038128	ERBB2 signaling pathway	A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0007265	Ras protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0038002	endocrine signaling	The transfer of information from one cell to another, where an endocrine hormone is transported from the signal-producing cell to the receiving cell via the circulatory system (via blood, lymph or cerebrospinal fluid). The signaling cell and the receiving cell are often distant to each other.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0060441	epithelial tube branching involved in lung morphogenesis	The process in which a highly ordered sequence of patterning events generates the branched epithelial tubes of the lung, consisting of reiterated combinations of bud outgrowth, elongation, and dichotomous subdivision of terminal units.
	GO:0021897	forebrain astrocyte development	The process aimed at the progression of an astrocyte that resides in the forebrain, from initial commitment of the cell to its fate, to the fully functional differentiated cell. An astrocyte is the most abundant type of glial cell. Astrocytes provide support for neurons and regulate the environment in which they function.
	GO:0048873	homeostasis of number of cells within a tissue	Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0045596	negative regulation of cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of cell differentiation.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0043406	positive regulation of MAP kinase activity	Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
	GO:0051092	positive regulation of NF-kappaB transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
	GO:0035022	positive regulation of Rac protein signal transduction	Any process that activates or increases the frequency, rate or extent of Rac protein signal transduction.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0051000	positive regulation of nitric-oxide synthase activity	Any process that activates or increases the activity of the enzyme nitric-oxide synthase.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0048169	regulation of long-term neuronal synaptic plasticity	A process that modulates long-term neuronal synaptic plasticity, the ability of neuronal synapses to change long-term as circumstances require. Long-term neuronal synaptic plasticity generally involves increase or decrease in actual synapse numbers.
	GO:0031647	regulation of protein stability	Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
	GO:0032228	regulation of synaptic transmission, GABAergic	Any process that modulates the frequency, rate or extent of GABAergic synaptic transmission, the process of communication from a neuron to another neuron across a synapse using the neurotransmitter gamma-aminobutyric acid (GABA).
	GO:0051384	response to glucocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
	GO:0051385	response to mineralocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mineralocorticoid stimulus. Mineralocorticoids are hormonal C21 corticosteroids synthesized from cholesterol and characterized by their similarity to aldosterone. Mineralocorticoids act primarily on water and electrolyte balance.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
	GO:0035176	social behavior	Behavior directed towards society, or taking place between members of the same species. Occurs predominantly, or only, in individuals that are part of a group.
	GO:0002223	stimulatory C-type lectin receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
	GO:0051146	striated muscle cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a striated muscle cell; striated muscle fibers are divided by transverse bands into striations, and cardiac and voluntary muscle are types of striated muscle.
	GO:0008542	visual learning	Any process in an organism in which a change in behavior of an individual occurs in response to repeated exposure to a visual cue.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 14)

Sites (14, 14)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (43, 231)

PROSITE Motifs (1, 6)

Exons (4, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (0, 0)

Gene Ontology (49, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File