Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  SMALL-MOLECULE LIGANDS BIND TO A DISTINCT POCKET IN RAS AND INHIBIT SOS-MEDIATED NUCLEOTIDE EXCHANGE ACTIVITY
 
Authors :  A. Oh, T. Maurer, L. S. Garrenton, K. Pitts, D. J. Anderson, N. J. Skelton B. P. Fauber, B. Pan, S. Malek, D. Stokoe, M. Ludlam, K. K. Bowman, J. Wu, A. M. Giannetti, M. A. Starovasnik, I. Mellman, P. K. Jackson, J. Ruldo G. Fang, W. Wang
Date :  19 Feb 12  (Deposition) - 04 Apr 12  (Release) - 06 Jun 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym./Biol. Unit :  A
Keywords :  Small G-Protein, Signaling, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Maurer, L. S. Garrenton, A. Oh, K. Pitts, D. J. Anderson, N. J. Skelton, B. P. Fauber, B. Pan, S. Malek, D. Stokoe, M. J. Ludlam, K. K. Bowman, J. Wu, A. M. Giannetti, M. A. Starovasnik, I. Mellman, P. K. Jackson, J. Rudolph, W. Wang, G. Fang
Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity.
Proc. Natl. Acad. Sci. Usa V. 109 5299 2012
PubMed-ID: 22431598  |  Reference-DOI: 10.1073/PNAS.1116510109

(-) Compounds

Molecule 1 - GTPASE KRAS, ISOFORM 2B
    Chains: A
    EC Number: 3.6.-.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: KRAS, KRAS2, RASK2
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: KRAS 4B, K-RAS 2, KI-RAS, C-K-RAS, C-KI-RAS, GTPASE KRAS, N- TERMINALLY PROCESSED

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 4)

Asymmetric/Biological Unit (4, 4)
No.NameCountTypeFull Name
1BEN1Ligand/IonBENZAMIDINE
2GOL1Ligand/IonGLYCEROL
3GSP1Ligand/Ion5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE
4MG1Ligand/IonMAGNESIUM ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:12 , GLY A:13 , VAL A:14 , GLY A:15 , LYS A:16 , SER A:17 , ALA A:18 , PHE A:28 , VAL A:29 , ASP A:30 , GLU A:31 , TYR A:32 , THR A:35 , GLY A:60 , ASN A:116 , LYS A:117 , ASP A:119 , LEU A:120 , SER A:145 , ALA A:146 , LYS A:147 , MG A:202 , HOH A:322 , HOH A:347 , HOH A:366 , HOH A:419 , HOH A:429 , HOH A:436BINDING SITE FOR RESIDUE GSP A 201
2AC2SOFTWARESER A:17 , THR A:35 , GSP A:201 , HOH A:322 , HOH A:366BINDING SITE FOR RESIDUE MG A 202
3AC3SOFTWARELEU A:6 , SER A:39 , ARG A:41 , ASP A:54 , LEU A:56 , THR A:74 , CYS A:118 , HOH A:316 , HOH A:317BINDING SITE FOR RESIDUE BEN A 203
4AC4SOFTWAREGLU A:62 , ARG A:68 , ASP A:92 , HIS A:95 , TYR A:96 , GLN A:99 , HOH A:384BINDING SITE FOR RESIDUE GOL A 204

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4DSO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4DSO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (43, 43)

Asymmetric/Biological Unit (43, 43)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_065144K5ERASK_HUMANDisease (NS3)193929331AK5E
02UniProtVAR_064849K5NRASK_HUMANDisease (GASC)104894361AK5N
03UniProtVAR_036305G12ARASK_HUMANUnclassified121913529AD12A
04CancerSNPVAR_RASK_HUMAN_CCDS8702_1_07 *G12ARASK_HUMANDisease (Colorectal cancer)  ---AD12A
05UniProtVAR_006839G12CRASK_HUMANUnclassified121913530AD12C
06UniProtVAR_016026G12DRASK_HUMANDisease (JMML)121913529AD12D
07CancerSNPVAR_RASK_HUMAN_CCDS8702_1_02 *G12DRASK_HUMANDisease (Colorectal cancer)  ---AD12D
08CancerSNPVAR_RASK_HUMAN_CCDS8702_1_03 *G12DRASK_HUMANDisease (Colorectal cancer)  ---AD12D
09CancerSNPVAR_RASK_HUMAN_CCDS8702_1_08 *G12DRASK_HUMANDisease (Colorectal cancer)  ---AD12D
10CancerSNPVAR_RASK_HUMAN_CCDS8702_1_09 *G12DRASK_HUMANDisease (Colorectal cancer)  ---AD12D
11UniProtVAR_016027G12RRASK_HUMANUnclassified121913530AD12R
12UniProtVAR_016028G12SRASK_HUMANDisease (JMML)121913530AD12S
13CancerSNPVAR_RASK_HUMAN_CCDS8702_1_01 *G12SRASK_HUMANDisease (Colorectal cancer)  ---AD12S
14UniProtVAR_006840G12VRASK_HUMANDisease (GASC)121913529AD12V
15CancerSNPVAR_RASK_HUMAN_CCDS8702_1_04 *G12VRASK_HUMANDisease (Colorectal cancer)  ---AD12V
16CancerSNPVAR_RASK_HUMAN_CCDS8702_1_05 *G12VRASK_HUMANDisease (Colorectal cancer)  ---AD12V
17CancerSNPVAR_RASK_HUMAN_CCDS8702_1_06 *G12VRASK_HUMANDisease (Colorectal cancer)  ---AD12V
18UniProtVAR_016029G13DRASK_HUMANDisease (JMML)112445441AG13D
19CancerSNPVAR_RASK_HUMAN_CCDS8702_1_10 *G13DRASK_HUMANDisease (Colorectal cancer)  ---AG13D
20CancerSNPVAR_RASK_HUMAN_CCDS8702_1_11 *G13DRASK_HUMANDisease (Colorectal cancer)  ---AG13D
21CancerSNPVAR_RASK_HUMAN_CCDS8702_1_12 *G13DRASK_HUMANDisease (Colorectal cancer)  ---AG13D
22UniProtVAR_065145G13RRASK_HUMANPolymorphism121913535AG13R
23UniProtVAR_026109V14IRASK_HUMANDisease (NS3)104894365AV14I
24UniProtVAR_064850Q22ERASK_HUMANDisease (CFC2)  ---AQ22E
25UniProtVAR_064851Q22RRASK_HUMANDisease (NS3)727503110AQ22R
26UniProtVAR_064852P34LRASK_HUMANDisease (NS3)104894366AP34L
27UniProtVAR_064853P34QRASK_HUMANDisease (NS3)  ---AP34Q
28UniProtVAR_026110P34RRASK_HUMANDisease (CFC2)104894366AP34R
29UniProtVAR_064854I36MRASK_HUMANDisease (NS3)727503109AI36M
30UniProtVAR_026111T58IRASK_HUMANDisease (NS3)104894364AT58I
31UniProtVAR_016030A59TRASK_HUMANDisease (GASC)121913528AA59T
32UniProtVAR_026112G60RRASK_HUMANDisease (CFC2)104894359AG60R
33UniProtVAR_065146G60SRASK_HUMANDisease (NS3)104894359AG60S
34UniProtVAR_006841Q61HRASK_HUMANUnclassified17851045AQ61H
35UniProtVAR_036306Q61RRASK_HUMANUnclassified121913240AQ61R
36CancerSNPVAR_RASK_HUMAN_CCDS8702_1_13 *Q61RRASK_HUMANDisease (Colorectal cancer)  ---AQ61R
37UniProtVAR_069784Y71HRASK_HUMANDisease (CFC2)387907205AY71H
38UniProtVAR_036307K117NRASK_HUMANUnclassified770248150AK117N
39CancerSNPVAR_RASK_HUMAN_CCDS8702_1_14 *K117NRASK_HUMANDisease (Colorectal cancer)  ---AK117N
40UniProtVAR_036308A146TRASK_HUMANUnclassified121913527AA146T
41CancerSNPVAR_RASK_HUMAN_CCDS8702_1_15 *A146TRASK_HUMANDisease (Colorectal cancer)  ---AA146T
42CancerSNPVAR_RASK_HUMAN_CCDS8702_1_16 *A146TRASK_HUMANDisease (Colorectal cancer)  ---AA146T
43UniProtVAR_069785K147ERASK_HUMANDisease (CFC2)387907206AK147E
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RASPS51421 small GTPase Ras family profile.RASK_HUMAN1-189  1A:2-180

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002560781ENSE00001189804chr12:25403854-25403685170RASK_HUMAN-00--
1.2aENST000002560782aENSE00000936617chr12:25398329-25398208122RASK_HUMAN1-37371A:1-3737
1.3ENST000002560783ENSE00001719809chr12:25380346-25380168179RASK_HUMAN38-97601A:38-9760
1.4ENST000002560784ENSE00001644818chr12:25378707-25378548160RASK_HUMAN97-150541A:97-15054
1.5bENST000002560785bENSE00001189807chr12:25368494-25368371124RASK_HUMAN151-189391A:151-180 (gaps)35
1.6bENST000002560786bENSE00001740851chr12:25362845-253581824664RASK_HUMAN-00--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:180
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     
           RASK_HUMAN     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKK 185
               SCOP domains d4dsoa_ A: automated matches                                                                                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....hhhhhhhhhhhh..........eeeeeeeeee..eeeeeeeeee........hhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhh......eeeeee.........hhhhhhhhhhhhh..eee.......hhhhhhhhhhhhhhhhh-hhhhhh...----.... Sec.struct. author
             SAPs(SNPs) (1) ----E------ADI-------E-----------L-M---------------------ITRH---------H---------------------------------------------N----------------------------TE-------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----N------AD--------R-----------Q-------------------------SR-------------------------------------------------------N----------------------------T--------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------CD--------------------R--------------------------R------------------------------------------------------------------------------------T--------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------DD---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------DR---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) -----------R----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE RAS  PDB: A:2-180 UniProt: 1-189                                                                                                                                                          PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:1-37 UniProt: 1-37 Exon 1.3  PDB: A:38-97 UniProt: 38-97                       -----------------------------------------------------Exon 1.5b  PDB: A:151-180 (gaps)    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:97-150 UniProt: 97-150               ----------------------------------- Transcript 1 (2)
                 4dso A   1 STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK-EKMSKDGKK----KKKK 180
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      |169      |  - |   
                                                                                                                                                                                                167 |     176  177   
                                                                                                                                                                                                  168                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4DSO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4DSO)

(-) Gene Ontology  (49, 49)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (RASK_HUMAN | P01116)
molecular function
    GO:0019003    GDP binding    Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
    GO:0019002    GMP binding    Interacting selectively and non-covalently with GMP, guanosine monophosphate.
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0030275    LRR domain binding    Interacting selectively and non-covalently with a LRR domain (leucine rich repeats) of a protein.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032403    protein complex binding    Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0007265    Ras protein signal transduction    A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
    GO:0030036    actin cytoskeleton organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
    GO:0007411    axon guidance    The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0038002    endocrine signaling    The transfer of information from one cell to another, where an endocrine hormone is transported from the signal-producing cell to the receiving cell via the circulatory system (via blood, lymph or cerebrospinal fluid). The signaling cell and the receiving cell are often distant to each other.
    GO:0007173    epidermal growth factor receptor signaling pathway    A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0060441    epithelial tube branching involved in lung morphogenesis    The process in which a highly ordered sequence of patterning events generates the branched epithelial tubes of the lung, consisting of reiterated combinations of bud outgrowth, elongation, and dichotomous subdivision of terminal units.
    GO:0021897    forebrain astrocyte development    The process aimed at the progression of an astrocyte that resides in the forebrain, from initial commitment of the cell to its fate, to the fully functional differentiated cell. An astrocyte is the most abundant type of glial cell. Astrocytes provide support for neurons and regulate the environment in which they function.
    GO:0048873    homeostasis of number of cells within a tissue    Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
    GO:0050900    leukocyte migration    The movement of a leukocyte within or between different tissues and organs of the body.
    GO:0045596    negative regulation of cell differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of cell differentiation.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:0043406    positive regulation of MAP kinase activity    Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0035022    positive regulation of Rac protein signal transduction    Any process that activates or increases the frequency, rate or extent of Rac protein signal transduction.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0051000    positive regulation of nitric-oxide synthase activity    Any process that activates or increases the activity of the enzyme nitric-oxide synthase.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0048169    regulation of long-term neuronal synaptic plasticity    A process that modulates long-term neuronal synaptic plasticity, the ability of neuronal synapses to change long-term as circumstances require. Long-term neuronal synaptic plasticity generally involves increase or decrease in actual synapse numbers.
    GO:0031647    regulation of protein stability    Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
    GO:0032228    regulation of synaptic transmission, GABAergic    Any process that modulates the frequency, rate or extent of GABAergic synaptic transmission, the process of communication from a neuron to another neuron across a synapse using the neurotransmitter gamma-aminobutyric acid (GABA).
    GO:0051384    response to glucocorticoid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
    GO:0051385    response to mineralocorticoid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mineralocorticoid stimulus. Mineralocorticoids are hormonal C21 corticosteroids synthesized from cholesterol and characterized by their similarity to aldosterone. Mineralocorticoids act primarily on water and electrolyte balance.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007264    small GTPase mediated signal transduction    Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
    GO:0035176    social behavior    Behavior directed towards society, or taking place between members of the same species. Occurs predominantly, or only, in individuals that are part of a group.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0051146    striated muscle cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a striated muscle cell; striated muscle fibers are divided by transverse bands into striations, and cardiac and voluntary muscle are types of striated muscle.
    GO:0008542    visual learning    Any process in an organism in which a change in behavior of an individual occurs in response to repeated exposure to a visual cue.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0031234    extrinsic component of cytoplasmic side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
    GO:0005925    focal adhesion    Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0045121    membrane raft    Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BEN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GSP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4dso)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4dso
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RASK_HUMAN | P01116
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.-.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  607785
    Disease Information: OMIM
  609942
    Disease Information: OMIM
  613659
    Disease Information: OMIM
  615278
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RASK_HUMAN | P01116
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RASK_HUMAN | P01116: 1d8d 1d8e 1kzo 1kzp 1n4p 1n4q 1n4r 1n4s 3gft 4dsn 4dst 4dsu 4epr 4ept 4epv 4epw 4epx 4epy 4l8g 4ldj 4lpk 4lrw 4luc 4lv6 4lyf 4lyh 4lyj 4m1o 4m1s 4m1t 4m1w 4m1y 4m21 4m22 4nmm 4obe 4pzy 4pzz 4q01 4q02 4q03 4ql3 4tq9 4tqa 4wa7 5f2e 5kyk 5tar 5tb5 5uqw 5us4 5usj 5v6s 5v6v 5xco

(-) Related Entries Specified in the PDB File

4dsn 4dst 4dsu