|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 4) Biological Unit 2 (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3UEV) |
SAPs(SNPs)/Variants (5, 5)
Asymmetric Unit (5, 5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3UEV) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:158 aligned with LACB_BOVIN | P02754 from UniProtKB/Swiss-Prot Length:178 Alignment length:162 26 36 46 56 66 76 86 96 106 116 126 136 146 156 166 176 LACB_BOVIN 17 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178 SCOP domains d3ueva_ A: beta-Lactoglobulin SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) --------------------------------------------Q----------L--H----D-----------------------------------------------------V-------------------------------------------- SAPs(SNPs) PROSITE --------LIPOCALIN -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 3uev A 1 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMEN----EQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 162 10 20 30 40 50 60 70 80 90 100 |- | 120 130 140 150 160 109 114
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3UEV) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3UEV) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (LACB_BOVIN | P02754)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|