Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  BOVINE BETA-LACTOGLOBULIN COMPLEX WITH TETRACAINE (BLG-TET)
 
Authors :  J. I. Loch, P. Bonarek, A. Polit, M. Jablonski, M. Czub, X. Ye, K. Lewinsk
Date :  06 Feb 15  (Deposition) - 01 Jul 15  (Release) - 08 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Transport, Ligand Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. I. Loch, P. Bonarek, A. Polit, M. Jabonski, M. Czub, X. Ye, K. Lewinsk
Beta-Lactoglobulin Interactions With Local Anaesthetic Drug - Crystallographic And Calorimetric Studies.
Int. J. Biol. Macromol. V. 80 87 2015
PubMed-ID: 26092174  |  Reference-DOI: 10.1016/J.IJBIOMAC.2015.06.013

(-) Compounds

Molecule 1 - BETA-LACTOGLOBULIN
    ChainsA
    FragmentUNP RESIDUES 17-178
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    SynonymBETA-LG

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1TE41Ligand/IonTETRACAINE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1TE42Ligand/IonTETRACAINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:38 , VAL A:41 , LEU A:54 , ILE A:56 , ILE A:71 , ILE A:84 , PHE A:105 , MET A:107 , HOH A:325binding site for residue TE4 A 201

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:66 -A:160
2A:106 -A:119

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4Y0P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Y0P)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Y0P)

(-) Exons   (0, 0)

(no "Exon" information available for 4Y0P)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:159
                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhee.eeeeeee.hhhhh........eeeeeeee.....eeeeeeee....eeeeeeeeee.....eeee.....eeeeeeee....eeeeeeee....eeeeeee.....hhhhhhhhhhhhhhh...eeee.hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4y0p A   1 LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 162
                                    10        20        30        40        50        60        70        80        90       100       110||     123       133       143       153         
                                                                                                                                        111|                                               
                                                                                                                                         115                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Y0P)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Y0P)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Y0P)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    TE4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4y0p)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4y0p
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LACB_BOVIN | P02754
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LACB_BOVIN | P02754
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LACB_BOVIN | P027541b0o 1b8e 1beb 1bso 1bsq 1bsy 1cj5 1dv9 1gx8 1gx9 1gxa 1qg5 1uz2 1yup 2akq 2blg 2gj5 2q2m 2q2p 2q39 2r56 3blg 3kza 3npo 3nq3 3nq9 3ph5 3ph6 3ueu 3uev 3uew 3uex 4dq3 4dq4 4gny 4ib6 4ib7 4ib8 4ib9 4iba 4kii 4lzu 4lzv 4y0q 4y0r 5eee 5htd 5hte 5io5 5io7 5k06 5lke 5lkf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Y0P)