1YUP - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   REINDEER BETA-LACTOGLOBULIN

Authors :   A. Goldman, E. Oksanen

Date :   14 Feb 05 (Deposition) - 14 Feb 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: E,F  (1x)
Biol. Unit 4: G,H  (1x)

Keywords :   Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. Oksanen, V. P. Jaakola, T. Tolonen, K. Valkonen, B. Akerstrom, N. Kalkkinen, V. Virtanen, A. Goldman
Reindeer Beta-Lactoglobulin Crystal Structure With Pseudo-Body-Centred Noncrystallographic Symmetry.
Acta Crystallogr. , Sect. D V. 62 1369 2006
PubMed-ID: 17057340 | Reference-DOI: 10.1107/S0907444906031519
(for further references see the PDB file header)

Molecule 1 - BETA-LACTOGLOBULIN
	Chains	:	A, B, C, D, E, F, G, H
	Organism Common	:	REINDEER
	Organism Scientific	:	RANGIFER TARANDUS
	Organism Taxid	:	9870
	Secretion	:	MILK

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:					E	F
Biological Unit 4 (1x)	:							G	H

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1YUP)

(no "Site" information available for 1YUP)

Asymmetric Unit

No.	Residues
1	A:66	-	A:160
2	A:106	-	A:119
3	B:66	-	B:160
4	B:106	-	B:119
5	C:66	-	C:160
6	C:106	-	C:119
7	D:66	-	D:160
8	D:106	-	D:119
9	E:66	-	E:160
10	E:106	-	E:119
11	F:66	-	F:160
12	F:106	-	F:119
13	G:66	-	G:160
14	G:106	-	G:119
15	H:66	-	H:160
16	H:106	-	H:119

(no "Cis Peptide Bond" information available for 1YUP)

Asymmetric Unit (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_LACB_BOVIN_001 *	E	61	Q	LACB_BOVIN	---	---	D	E	45	Q
2	UniProt	VAR_LACB_BOVIN_002 *	I	72	L	LACB_BOVIN	---	---	D	I	56	L
3	UniProt	VAR_LACB_BOVIN_003 *	Q	75	H	LACB_BOVIN	---	---	D	Q	59	H
4	UniProt	VAR_LACB_BOVIN_004 *	G	80	D	LACB_BOVIN	---	---	D	G	64	D
5	UniProt	VAR_LACB_BOVIN_005 *	A	134	V	LACB_BOVIN	---	---	D	A	118	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_LACB_BOVIN_001 *	E	61	Q	LACB_BOVIN	---	---	D	E	45	Q
2	UniProt	VAR_LACB_BOVIN_002 *	I	72	L	LACB_BOVIN	---	---	D	I	56	L
3	UniProt	VAR_LACB_BOVIN_003 *	Q	75	H	LACB_BOVIN	---	---	D	Q	59	H
4	UniProt	VAR_LACB_BOVIN_004 *	G	80	D	LACB_BOVIN	---	---	D	G	64	D
5	UniProt	VAR_LACB_BOVIN_005 *	A	134	V	LACB_BOVIN	---	---	D	A	118	V
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LIPOCALIN	PS00213	Lipocalin signature.	LACB_BOVIN	25-38	1	D:10-22

Biological Unit 1 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LIPOCALIN	PS00213	Lipocalin signature.	LACB_BOVIN	25-38	0	-

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LIPOCALIN	PS00213	Lipocalin signature.	LACB_BOVIN	25-38	1	D:10-22

Biological Unit 3 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LIPOCALIN	PS00213	Lipocalin signature.	LACB_BOVIN	25-38	0	-

Biological Unit 4 (, 0)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	LIPOCALIN	PS00213	Lipocalin signature.	LACB_BOVIN	25-38	0	-

(no "Exon" information available for 1YUP)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:162
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:162
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178  
         Q00P86_RANTA    19 IIVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 180
               SCOP domains d1yupa1 A:1-162 beta-Lactoglobulin                                                                                                                                 SCOP domains
               CATH domains 1yupA00 A:1-162  [code=2.40.128.20, no name defined]                                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhhhee.eeeeeee.hhhhhh........eeeeeee.....eeeeeeee....eeeeeeeeee.....eee.......eeeeeee....eeeeeee.........eeeeee.....hhhhhhhhhhhhh.....eeee.hhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1yup A   1 IIVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 162
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160

Chain B from PDB  Type:PROTEIN  Length:158
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:158
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170        
         Q00P86_RANTA    21 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 178
               SCOP domains d1yupb_ B: automated matches                                                                                                                                   SCOP domains
               CATH domains 1yupB00 B:3-160  [code=2.40.128.20, no name defined]                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............ee.eeeeeee.hhhhhh........eeeeeee.....eeeeeeee....eeeeeeee.......eeeeee..eeeeeeeee....eeeeeee...hhhhhheeeeee.....hhhhhhhhhhhhhh....eeee.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup B   3 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 160
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152

Chain C from PDB  Type:PROTEIN  Length:160
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:160
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180
         Q00P86_RANTA    21 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 180
               SCOP domains d1yupc_ C: automated matches                                                                                                                                     SCOP domains
               CATH domains 1yupC00 C:3-162  [code=2.40.128.20, no name defined]                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhee.eeeeeee.hhhhh.........eeeeeee.....eeeeeeeee..eeeeeeeeeee.....eeeeee..eeeeeeeee....eeeeeee.........eeeeee.....hhhhhhhhhhhhh.....eeee.hhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup C   3 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 162
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162

Chain D from PDB  Type:PROTEIN  Length:158
 aligned with LACB_BOVIN | P02754 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:158
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168        
           LACB_BOVIN    19 VTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQC 176
               SCOP domains d1yupd_ D: automated matches                                                                                                                                   SCOP domains
               CATH domains 1yupD00 D:3-160  [code=2.40.128.20, no name defined]                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhee.eeeeeee.hhhhh.........eeeeeee.....eeeeeeee....eeeeeeeeee.....eeeeee..eeeeeeeee....eeeeeee...hhhhh.eeeeee.....hhhhhhhhhhhhhh....eeee.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------Q----------L--H----D-----------------------------------------------------V------------------------------------------ SAPs(SNPs)
                    PROSITE ------LIPOCALIN     ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup D   3 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 160
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152

Chain D from PDB  Type:PROTEIN  Length:158
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:158
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170        
         Q00P86_RANTA    21 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 178
               SCOP domains d1yupd_ D: automated matches                                                                                                                                   SCOP domains
               CATH domains 1yupD00 D:3-160  [code=2.40.128.20, no name defined]                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhee.eeeeeee.hhhhh.........eeeeeee.....eeeeeeee....eeeeeeeeee.....eeeeee..eeeeeeeee....eeeeeee...hhhhh.eeeeee.....hhhhhhhhhhhhhh....eeee.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------Q----------L--H----D-----------------------------------------------------V------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup D   3 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 160
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152

Chain E from PDB  Type:PROTEIN  Length:154
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:154
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176    
         Q00P86_RANTA    27 DLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 180
               SCOP domains d1yupe_ E: beta-Lactoglobulin                                                                                                                              SCOP domains
               CATH domains 1yupE00 E:9-162  [code=2.40.128.20, no name defined]                                                                                                       CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhee.eeeeeee.hhhhh.........eeeeeee.....eeeeeeeee..eeeeeeeeeee.....eeeeee..eeeeeeeee....eeeeeee....hhhh.eeeeee.....hhhhhhhhhhhhh.....eeee.hhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup E   9 DLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 162
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158

Chain F from PDB  Type:PROTEIN  Length:159
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:159
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169         
         Q00P86_RANTA    20 IVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 178
               SCOP domains d1yupf_ F: automated matches                                                                                                                                    SCOP domains
               CATH domains 1yupF00 F:2-160  [code=2.40.128.20, no name defined]                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhee.eeeeeee.hhhhhh........eeeeeee.....eeeeeeee....eeeeeeeeee.....eeeeee..eeeeeeeee....eeeeeee...hhhhh.eeeeee.....hhhhhhhhhhhhhh....eeee.hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup F   2 IVTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 160
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain G from PDB  Type:PROTEIN  Length:160
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:160
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180
         Q00P86_RANTA    21 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 180
               SCOP domains d1yupg_ G: automated matches                                                                                                                                     SCOP domains
               CATH domains 1yupG00 G:3-162  [code=2.40.128.20, no name defined]                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhee.eeeeeee.hhhhh.........eeeeeee.....eeeeeeee....eeeeeeeeee.....eeeeee..eeeeeeeee....eeeeeee.........eeeeee.....hhhhhhhhhhhhhh....eeee.hhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup G   3 VTQTMKDLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQCRV 162
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162

Chain H from PDB  Type:PROTEIN  Length:152
 aligned with Q00P86_RANTA | Q00P86 from UniProtKB/TrEMBL  Length:180

    Alignment length:152
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176  
         Q00P86_RANTA    27 DLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 178
               SCOP domains d1yuph_ H: beta-Lactoglobulin                                                                                                                            SCOP domains
               CATH domains 1yupH00 H:9-160  [code=2.40.128.20, no name defined]                                                                                                     CATH domains
           Pfam domains (1) -------Lipocalin-1yupH01 H:16-157                                                                                                                    --- Pfam domains (1)
           Pfam domains (2) -------Lipocalin-1yupH02 H:16-157                                                                                                                    --- Pfam domains (2)
           Pfam domains (3) -------Lipocalin-1yupH03 H:16-157                                                                                                                    --- Pfam domains (3)
           Pfam domains (4) -------Lipocalin-1yupH04 H:16-157                                                                                                                    --- Pfam domains (4)
           Pfam domains (5) -------Lipocalin-1yupH05 H:16-157                                                                                                                    --- Pfam domains (5)
           Pfam domains (6) -------Lipocalin-1yupH06 H:16-157                                                                                                                    --- Pfam domains (6)
           Pfam domains (7) -------Lipocalin-1yupH07 H:16-157                                                                                                                    --- Pfam domains (7)
           Pfam domains (8) -------Lipocalin-1yupH08 H:16-157                                                                                                                    --- Pfam domains (8)
         Sec.struct. author ..hhhhh.ee.eeeeeee.hhhhh........eeeeeeee.....eeeeeeee....eeeeeeee.......eeeeee..eeeeeeeee....eeeeeee.........eeeeee.....hhhhhhhhhhhhhhh...eeee...hhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1yup H   9 DLDVQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPGGDLEILLQKWENGKCAQKKIIAEKTEIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEAMEKFDKALKALPMHIRLSFNPTQLEEQC 160
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Lipocalins (514)

Superfamily: Lipocalins (514)

Family: Retinol binding protein-like (261)

Protein domain: automated matches (36)

Reindeer (Rangifer tarandus) [TaxId: 9870] (1)

1a	d1yupb_	B:
1b	d1yupc_	C:
1c	d1yupd_	D:
1d	d1yupf_	F:
1e	d1yupg_	G:

Protein domain: beta-Lactoglobulin (41)

Reindeer (Rangifer tarandus) [TaxId: 9870] (1)

2a	d1yupa1	A:1-162
2b	d1yupe_	E:
2c	d1yuph_	H:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: Lipocalin (526)

Homologous Superfamily: [code=2.40.128.20, no name defined] (352)

Reindeer (Rangifer tarandus) (1)

1a	1yupE00	E:9-162
1b	1yupH00	H:9-160
1c	1yupB00	B:3-160
1d	1yupD00	D:3-160
1e	1yupF00	F:2-160
1f	1yupC00	C:3-162
1g	1yupG00	G:3-162
1h	1yupA00	A:1-162

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Calycin (163)

Family: Lipocalin (123)

Rangifer tarandus tarandus (1)

1a	Lipocalin-1yupH01	H:16-157
1b	Lipocalin-1yupH02	H:16-157
1c	Lipocalin-1yupH03	H:16-157
1d	Lipocalin-1yupH04	H:16-157
1e	Lipocalin-1yupH05	H:16-157
1f	Lipocalin-1yupH06	H:16-157
1g	Lipocalin-1yupH07	H:16-157
1h	Lipocalin-1yupH08	H:16-157

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H (Q00P86_RANTA | Q00P86)

molecular function
	GO:0036094	small molecule binding	Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
biological process
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain D (LACB_BOVIN | P02754)

molecular function
	GO:0019841	retinol binding	Interacting selectively and non-covalently with retinol, vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A. Retinol is an intermediate in the vision cycle and it also plays a role in growth and differentiation.
	GO:0036094	small molecule binding	Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
biological process
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1yup)

	Sites
(no "Sites" information available for 1yup)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1yup)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1yup
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	LACB_BOVIN \| P02754
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q00P86_RANTA \| Q00P86
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	LACB_BOVIN \| P02754
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q00P86_RANTA \| Q00P86
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1YUP)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (16, 16)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 5)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (1, 8)

Pfam Domains (1, 8)

Gene Ontology (4, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File