Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  BOVINE BETA-LACTOGLOBULIN COMPLEXED WITH PALMITATE, LATTICE Z
 
Authors :  S. -Y. Wu, L. Sawyer
Date :  11 Nov 98  (Deposition) - 02 Feb 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Lipocalin, Milk Whey Protein, Bovine, Palmitate-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Y. Wu, M. D. Perez, P. Puyol, L. Sawyer
Beta-Lactoglobulin Binds Palmitate Within Its Central Cavity.
J. Biol. Chem. V. 274 170 1999
PubMed-ID: 9867826  |  Reference-DOI: 10.1074/JBC.274.1.170
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BETA-LACTOGLOBULIN
    Cellular LocationEXTRACELLULAR
    ChainsA
    OrganMAMMARY GLAND
    Organism CommonCATTLE
    Organism ScientificBOS TAURUS
    Organism Taxid9913
    Other DetailsPROTEIN PURCHASED FROM SIGMA CHEMICALS, LOT 13H7150
    SecretionMILK
    VariantGENETIC VARIANT B

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1PLM1Ligand/IonPALMITIC ACID
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1PLM2Ligand/IonPALMITIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:41 , LEU A:46 , LEU A:54 , LYS A:60 , GLU A:62 , LYS A:69 , ILE A:84 , VAL A:94 , PHE A:105 , MET A:107BINDING SITE FOR RESIDUE PLM A 180
2PBSUNKNOWNLEU A:46 , PHE A:105 , MET A:107 , VAL A:41 , LYS A:69 , LYS A:60 , ILE A:71 , ILE A:84 , ILE A:56 , LEU A:103 , VAL A:94FATTY ACID (PALMITATE ) BINDING SITE

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:66 -A:160
2A:106 -A:119

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1B0O)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (5, 5)

Asymmetric Unit (5, 5)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_LACB_BOVIN_001 *E61QLACB_BOVIN  ---  ---AE45Q
2UniProtVAR_LACB_BOVIN_002 *I72LLACB_BOVIN  ---  ---AI56L
3UniProtVAR_LACB_BOVIN_003 *Q75HLACB_BOVIN  ---  ---AQ59H
4UniProtVAR_LACB_BOVIN_004 *G80DLACB_BOVIN  ---  ---AG64D
5UniProtVAR_LACB_BOVIN_005 *A134VLACB_BOVIN  ---  ---AA118V
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (5, 10)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_LACB_BOVIN_001 *E61QLACB_BOVIN  ---  ---AE45Q
2UniProtVAR_LACB_BOVIN_002 *I72LLACB_BOVIN  ---  ---AI56L
3UniProtVAR_LACB_BOVIN_003 *Q75HLACB_BOVIN  ---  ---AQ59H
4UniProtVAR_LACB_BOVIN_004 *G80DLACB_BOVIN  ---  ---AG64D
5UniProtVAR_LACB_BOVIN_005 *A134VLACB_BOVIN  ---  ---AA118V
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPOCALINPS00213 Lipocalin signature.LACB_BOVIN25-38  1A:9-22
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPOCALINPS00213 Lipocalin signature.LACB_BOVIN25-38  2A:9-22

(-) Exons   (0, 0)

(no "Exon" information available for 1B0O)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:161
 aligned with LACB_BOVIN | P02754 from UniProtKB/Swiss-Prot  Length:178

    Alignment length:161
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177 
           LACB_BOVIN    18 IVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 178
               SCOP domains d1b0oa_ A: beta-Lactoglobulin                                                                                                                                     SCOP domains
               CATH domains 1b0oA00 A:2-162  [code=2.40.128.20, no name defined]                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhh....eeeeeee..hhh..........eeeeeee.....eeeeeeee....eeeeeeeeee.....eeee.....eeeeeeee....eeeeeee........eeeeeee......hhhhhhhhhhhh.....eeee..hhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------Q----------L--H----D-----------------------------------------------------V-------------------------------------------- SAPs(SNPs)
                    PROSITE -------LIPOCALIN     -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1b0o A   2 IVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI 162
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1B0O)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A   (LACB_BOVIN | P02754)
molecular function
    GO:0019841    retinol binding    Interacting selectively and non-covalently with retinol, vitamin A1, 2,6,6-trimethyl-1-(9'-hydroxy-3',7'-dimethylnona-1',3',5',7'-tetraenyl)cyclohex-1-ene, one of the three components that makes up vitamin A. Retinol is an intermediate in the vision cycle and it also plays a role in growth and differentiation.
    GO:0036094    small molecule binding    Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
biological process
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PLM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    PBS  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1b0o)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1b0o
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LACB_BOVIN | P02754
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LACB_BOVIN | P02754
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LACB_BOVIN | P027541b8e 1beb 1bso 1bsq 1bsy 1cj5 1dv9 1gx8 1gx9 1gxa 1qg5 1uz2 1yup 2akq 2blg 2gj5 2q2m 2q2p 2q39 2r56 3blg 3kza 3npo 3nq3 3nq9 3ph5 3ph6 3ueu 3uev 3uew 3uex 4dq3 4dq4 4gny 4ib6 4ib7 4ib8 4ib9 4iba 4kii 4lzu 4lzv 4y0p 4y0q 4y0r 5eee 5htd 5hte 5io5 5io7 5k06 5lke 5lkf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1B0O)