|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3PMF) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3PMF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3PMF) |
PROSITE Motifs (3, 3)| Asymmetric/Biological Unit (3, 3) |
Exons (0, 0)| (no "Exon" information available for 3PMF) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:129 aligned with NUC_STAAU | P00644 from UniProtKB/Swiss-Prot Length:231 Alignment length:135 98 108 118 128 138 148 158 168 178 188 198 208 218 NUC_STAAU 89 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS 223 SCOP domains d3pmfa_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -TNASE_3 PDB: A:8-141 UniProt: 90-224 PROSITE (1) PROSITE (2) ------------TNASE_1 PDB: A:19-43 ---------------------------------------TNASE_2 ------------------------------------------------ PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript 3pmf A 7 LHKEPATLIKAIDGDTAKLMYKGQPMTFRLLLVDTPE------FNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS 141 16 26 36 | - | 56 66 76 86 96 106 116 126 136 43 50
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3PMF) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3PMF) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (NUC_STAAU | P00644)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|