|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2EYL) |
Sites (0, 0)| (no "Site" information available for 2EYL) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EYL) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EYL) |
PROSITE Motifs (3, 3)| Asymmetric/Biological Unit (3, 3) |
Exons (0, 0)| (no "Exon" information available for 2EYL) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:136 aligned with NUC_STAAU | P00644 from UniProtKB/Swiss-Prot Length:231 Alignment length:136 97 107 117 127 137 147 157 167 177 187 197 207 217 NUC_STAAU 88 KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS 223 SCOP domains d2eyla_ A: Staphylococcal nuclease SCOP domains CATH domains 2eylA00 A:6-141 [code=2.40.50.90, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --TNASE_3 PDB: A:8-141 UniProt: 90-224 PROSITE (1) PROSITE (2) -------------TNASE_1 PDB: A:19-43 ---------------------------------------TNASE_2 ------------------------------------------------ PROSITE (2) Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript 2eyl A 6 KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRSDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS 141 15 25 35 45 55 65 75 85 95 105 115 125 135
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EYL) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (NUC_STAAU | P00644)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|