|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1RKN) |
(no "Site" information available for 1RKN) |
(no "SS Bond" information available for 1RKN) |
(no "Cis Peptide Bond" information available for 1RKN) |
(no "SAP(SNP)/Variant" information available for 1RKN) |
NMR Structure (3, 3) |
(no "Exon" information available for 1RKN) |
NMR StructureChain A from PDB Type:PROTEIN Length:110 aligned with A5A520_STAAU | A5A520 from UniProtKB/TrEMBL Length:215 Alignment length:110 78 88 98 108 118 128 138 148 158 168 178 A5A520_STAAU 69 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAK 178 SCOP domains d1rkna_ A: Staphylococcal nuclease SCOP domains CATH domains 1rknA00 A:1-110 [code=2.40.50.90, no name defined] CATH domains Pfam domains --------------------------------SNase-1rknA01 A:33-110 Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1rkn A 1 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRWLAYIYADGKMVNEALVRQGLAK 110 10 20 30 40 50 60 70 80 90 100 110 Chain A from PDB Type:PROTEIN Length:110 aligned with NUC_STAAU | P00644 from UniProtKB/Swiss-Prot Length:231 Alignment length:110 92 102 112 122 132 142 152 162 172 182 192 NUC_STAAU 83 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAK 192 SCOP domains d1rkna_ A: Staphylococcal nuclease SCOP domains CATH domains 1rknA00 A:1-110 [code=2.40.50.90, no name defined] CATH domains Pfam domains --------------------------------SNase-1rknA01 A:33-110 Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -------TNASE_3 PDB: A:8-110 UniProt: 90-224 PROSITE (1) PROSITE (2) ------------------TNASE_1 PDB: A:19-43 ---------------------------------------TNASE_2 ----------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------- Transcript 1rkn A 1 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRWLAYIYADGKMVNEALVRQGLAK 110 10 20 30 40 50 60 70 80 90 100 110
|
NMR Structure |
NMR Structure
|
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A (A5A520_STAAU | A5A520)
Chain A (NUC_STAAU | P00644)
|
|
|
|
|
|
|