|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1SND) |
Sites (0, 0)| (no "Site" information available for 1SND) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1SND) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1SND) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SND) |
PROSITE Motifs (3, 6)
Asymmetric Unit (3, 6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1SND) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:129 aligned with NUC_STAAU | P00644 from UniProtKB/Swiss-Prot Length:231 Alignment length:135 98 108 118 128 138 148 158 168 178 188 198 208 218 NUC_STAAU 89 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS 223 SCOP domains d1snda_ A: Staphylococcal nuclease SCOP domains CATH domains 1sndA00 A:7-141 [code=2.40.50.90, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -TNASE_3 PDB: A:8-141 UniProt: 90-224 PROSITE (1) PROSITE (2) ------------TNASE_1 PDB: A:19-43 ---------------------------------------TNASE_2 ------------------------------------------------ PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript 1snd A 7 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAY------THEQHLRKSEAQAKKEKLNIWS 141 16 26 36 46 56 66 76 86 96 106 | - | 126 136 113 120 Chain B from PDB Type:PROTEIN Length:129 aligned with NUC_STAAU | P00644 from UniProtKB/Swiss-Prot Length:231 Alignment length:135 98 108 118 128 138 148 158 168 178 188 198 208 218 NUC_STAAU 89 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS 223 SCOP domains d1sndb_ B: Staphylococcal nuclease SCOP domains CATH domains 1sndB00 B:7-141 [code=2.40.50.90, no name defined] CATH domains Pfam domains (1) --------------------------SNase-1sndB01 B:33-141 Pfam domains (1) Pfam domains (2) --------------------------SNase-1sndB02 B:33-141 Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -TNASE_3 PDB: B:8-141 UniProt: 90-224 PROSITE (1) PROSITE (2) ------------TNASE_1 PDB: B:19-43 ---------------------------------------TNASE_2 ------------------------------------------------ PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript 1snd B 7 LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAY------THEQHLRKSEAQAKKEKLNIWS 141 16 26 36 46 56 66 76 86 96 106 | - | 126 136 113 120
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A,B (NUC_STAAU | P00644)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|