3NKF - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN LIGAND-FREE MATURE CASPASE-6 WITH INTERSUBUNIT LINKER ATTACHED

Authors :   S. Vaidya, J. A. Hardy

Date :   18 Jun 10 (Deposition) - 08 Dec 10 (Release) - 09 Feb 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: A,B  (1x)
Biol. Unit 3: C,D  (1x)

Keywords :   Caspase, Protease, Apoptosis, Zymogen, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Vaidya, E. M. Velazquez-Delgado, G. Abbruzzese, J. A. Hardy
Substrate-Induced Conformational Changes Occur In All Cleaved Forms Of Caspase-6.
J. Mol. Biol. V. 406 75 2011
PubMed-ID: 21111746 | Reference-DOI: 10.1016/J.JMB.2010.11.031

Molecule 1 - CASPASE-6
	Chains	:	A, B, C, D
	EC Number	:	3.4.22.59
	Engineered	:	YES
	Mutation	:	YES
	Organism Taxid	:	32630
	Other Details	:	E.COLI OPTIMIZED SYNTHETIC GENE
	Synonym	:	CASP-6, APOPTOTIC PROTEASE MCH-2, CASPASE-6 SUBUNIT P18, CASPASE-6 SUBUNIT P11
	Synthetic	:	YES

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:	A	B
Biological Unit 3 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3NKF)

(no "Site" information available for 3NKF)

(no "SS Bond" information available for 3NKF)

(no "Cis Peptide Bond" information available for 3NKF)

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_029242	E	35	K	CASP6_HUMAN	Polymorphism	11574697	A/B/C/D	E	35	K
2	UniProt	VAR_016130	A	109	T	CASP6_HUMAN	Polymorphism	5030674	A/B/C/D	A	109	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_029242	E	35	K	CASP6_HUMAN	Polymorphism	11574697	A/B/C/D	E	35	K
2	UniProt	VAR_016130	A	109	T	CASP6_HUMAN	Polymorphism	5030674	A/B/C/D	A	109	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_029242	E	35	K	CASP6_HUMAN	Polymorphism	11574697	A/B	E	35	K
2	UniProt	VAR_016130	A	109	T	CASP6_HUMAN	Polymorphism	5030674	A/B	A	109	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_029242	E	35	K	CASP6_HUMAN	Polymorphism	11574697	C/D	E	35	K
2	UniProt	VAR_016130	A	109	T	CASP6_HUMAN	Polymorphism	5030674	C/D	A	109	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (4, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP6_HUMAN	43-167	4	A:43-163 B:43-164 C:43-163 D:43-163
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP6_HUMAN	108-122	4	A:108-122 B:108-122 C:108-122 D:108-122
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP6_HUMAN	154-165	4	A:154-163 B:154-164 C:154-163 D:154-163
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP6_HUMAN	196-290	4	A:198-290 B:202-290 C:197-290 D:198-290

Biological Unit 1 (4, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP6_HUMAN	43-167	4	A:43-163 B:43-164 C:43-163 D:43-163
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP6_HUMAN	108-122	4	A:108-122 B:108-122 C:108-122 D:108-122
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP6_HUMAN	154-165	4	A:154-163 B:154-164 C:154-163 D:154-163
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP6_HUMAN	196-290	4	A:198-290 B:202-290 C:197-290 D:198-290

Biological Unit 2 (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP6_HUMAN	43-167	2	A:43-163 B:43-164 - -
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP6_HUMAN	108-122	2	A:108-122 B:108-122 - -
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP6_HUMAN	154-165	2	A:154-163 B:154-164 - -
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP6_HUMAN	196-290	2	A:198-290 B:202-290 - -

Biological Unit 3 (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CASPASE_P20	PS50208	Caspase family p20 domain profile.	CASP6_HUMAN	43-167	2	- - C:43-163 D:43-163
2	CASPASE_HIS	PS01121	Caspase family histidine active site.	CASP6_HUMAN	108-122	2	- - C:108-122 D:108-122
3	CASPASE_CYS	PS01122	Caspase family cysteine active site.	CASP6_HUMAN	154-165	2	- - C:154-163 D:154-163
4	CASPASE_P10	PS50207	Caspase family p10 domain profile.	CASP6_HUMAN	196-290	2	- - C:197-290 D:198-290

Asymmetric Unit (5, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000265164	1b	ENSE00001018825	chr4:110624629-110624512	118	CASP6_HUMAN	1-14	14	0	-	-
1.3	ENST00000265164	3	ENSE00000935048	chr4:110619498-110619456	43	CASP6_HUMAN	14-28	15	0	-	-
1.4b	ENST00000265164	4b	ENSE00000935047	chr4:110618924-110618778	147	CASP6_HUMAN	28-77	50	4	A:31-77 B:31-77 C:31-77 D:31-77	47 47 47 47
1.5b	ENST00000265164	5b	ENSE00000935046	chr4:110617642-110617566	77	CASP6_HUMAN	77-103	27	4	A:77-103 B:77-103 C:77-103 D:77-103	27 27 27 27
1.6c	ENST00000265164	6c	ENSE00000935045	chr4:110615856-110615681	176	CASP6_HUMAN	103-161	59	4	A:103-161 B:103-161 C:103-161 D:103-161	59 59 59 59
1.7c	ENST00000265164	7c	ENSE00000935044	chr4:110612165-110612006	160	CASP6_HUMAN	162-215	54	4	A:162-215 (gaps) B:162-215 (gaps) C:162-215 (gaps) D:162-215 (gaps)	54 54 54 54
1.8d	ENST00000265164	8d	ENSE00001820381	chr4:110610724-110609898	827	CASP6_HUMAN	215-293	79	4	A:215-292 (gaps) B:215-290 (gaps) C:215-293 (gaps) D:215-291 (gaps)	78 76 79 77

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:219
 aligned with CASP6_HUMAN | P55212 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:262
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290  
          CASP6_HUMAN    31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS 292
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eeeeeeeee........hhhhhhhhhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhhhhhh....eeeeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhh...eeeee...----------------------------------........eeeee...............hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.---------........eeee............ Sec.struct. author
                 SAPs(SNPs) ----K-------------------------------------------------------------------------T--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------CASPASE_P20  PDB: A:43-163 UniProt: 43-167                                                                                   ----------------------------CASPASE_P10  PDB: A:198-290 UniProt: 196-290                                                   -- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4b  PDB: A:31-77 UniProt: 28-77         -------------------------Exon 1.6c  PDB: A:103-161 UniProt: 103-161                 Exon 1.7c  PDB: A:162-215 (gaps) UniProt: 162-215     ----------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.5b  PDB: A:77-103   ---------------------------------------------------------------------------------------------------------------Exon 1.8d  PDB: A:215-292 (gaps) UniProt: 215-293 [INCOMPLETE]                 Transcript 1 (2)
                 3nkf A  31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAC----------------------------------YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQR---------AIGKKQVPCFASMLTKKLHFFPKS 292
                                    40        50        60        70        80        90       100       110       120       130       140       150       160  |      -         -         -       200       210       220       230       240       250        |-       270       280       290  
                                                                                                                                                              163                                198                                                          259       269

Chain B from PDB  Type:PROTEIN  Length:213
 aligned with CASP6_HUMAN | P55212 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:260
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290
          CASP6_HUMAN    31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFP 290
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeee.......hhhhhhhhhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhhhhhh.......eeeeeee....hhhhhhhhhhhhhhhhhhh....hhhhh...eeeee....-------------------------------------....eeeee.........--....hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh--------....eeee.......... Sec.struct. author
                 SAPs(SNPs) ----K-------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------CASPASE_P20  PDB: B:43-164 UniProt: 43-167                                                                                   ----------------------------CASPASE_P10  PDB: B:202-290 UniProt: 196-290                                                    PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ----------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4b  PDB: B:31-77 UniProt: 28-77         -------------------------Exon 1.6c  PDB: B:103-161 UniProt: 103-161                 Exon 1.7c  PDB: B:162-215 (gaps) UniProt: 162-215     --------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.5b  PDB: B:77-103   ---------------------------------------------------------------------------------------------------------------Exon 1.8d  PDB: B:215-290 (gaps) UniProt: 215-293 [INCOMPLETE]               Transcript 1 (2)
                 3nkf B  31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACR-------------------------------------AGADFLMCYSVAEGYYSH--TVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFC--------KQVPCFASMLTKKLHFFP 290
                                    40        50        60        70        80        90       100       110       120       130       140       150       160   |     -         -         -         - |     210        |- |     230       240       250       260   |     -  |    280       290
                                                                                                                                                               164                                   202              219  |                                       264      273                 
                                                                                                                                                                                                                         222

Chain C from PDB  Type:PROTEIN  Length:222
 aligned with CASP6_HUMAN | P55212 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:264
                                                                                                                                                                                                                                                                                                293 
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290  | 
          CASP6_HUMAN    31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN-   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............eeeeeee........hhhhhhhhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhh.......eeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhh...eeeee...---------------------------------.........eeeee...............hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh...---------......eeee.............. Sec.struct. author
                 SAPs(SNPs) ----K-------------------------------------------------------------------------T----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------CASPASE_P20  PDB: C:43-163 UniProt: 43-167                                                                                   ----------------------------CASPASE_P10  PDB: C:197-290 UniProt: 196-290                                                   ---- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS --------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.4b  PDB: C:31-77 UniProt: 28-77         -------------------------Exon 1.6c  PDB: C:103-161 UniProt: 103-161                 Exon 1.7c  PDB: C:162-215 (gaps) UniProt: 162-215     ------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.5b  PDB: C:77-103   ---------------------------------------------------------------------------------------------------------------Exon 1.8d  PDB: C:215-293 (gaps) UniProt: 215-293                              - Transcript 1 (2)
                 3nkf C  31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAC---------------------------------VYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRV---------GKKQVPCFASMLTKKLHFFPKSNH 294
                                    40        50        60        70        80        90       100       110       120       130       140       150       160  |      -         -         -      |200       210       220       230       240       250       260|        -|      280       290    
                                                                                                                                                              163                               197                                                             261       271

Chain D from PDB  Type:PROTEIN  Length:220
 aligned with CASP6_HUMAN | P55212 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:261
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290 
          CASP6_HUMAN    31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK 291
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------Peptidase_C14-3nkfD01 D:45-288                                                                                                                                                                                                                      --- Pfam domains (1)
           Pfam domains (2) --------------Peptidase_C14-3nkfD02 D:45-288                                                                                                                                                                                                                      --- Pfam domains (2)
           Pfam domains (3) --------------Peptidase_C14-3nkfD03 D:45-288                                                                                                                                                                                                                      --- Pfam domains (3)
           Pfam domains (4) --------------Peptidase_C14-3nkfD04 D:45-288                                                                                                                                                                                                                      --- Pfam domains (4)
         Sec.struct. author ...............eeeeee........hhhhhhhhhhhhhhhhhhhhh...eeeeee..hhhhhhhhhhhhhhh.......eeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhh...eeeee...----------------------------------........eeeee...............hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh-------..........eeee........... Sec.struct. author
                 SAPs(SNPs) ----K-------------------------------------------------------------------------T-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------CASPASE_P20  PDB: D:43-163 UniProt: 43-167                                                                                   ----------------------------CASPASE_P10  PDB: D:198-290 UniProt: 196-290                                                   - PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 1 (1) Exon 1.4b  PDB: D:31-77 UniProt: 28-77         -------------------------Exon 1.6c  PDB: D:103-161 UniProt: 103-161                 Exon 1.7c  PDB: D:162-215 (gaps) UniProt: 162-215     ---------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------Exon 1.5b  PDB: D:77-103   ---------------------------------------------------------------------------------------------------------------Exon 1.8d  PDB: D:215-291 (gaps) UniProt: 215-293 [INCOMPLETE]                Transcript 1 (2)
                 3nkf D  31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAC----------------------------------YTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQR-------PSAIGKKQVPCFASMLTKKLHFFPK 291
                                    40        50        60        70        80        90       100       110       120       130       140       150       160  |      -         -         -       200       210       220       230       240       250        |-      |270       280       290 
                                                                                                                                                              163                                198                                                          259     267

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3NKF)

(no "CATH Domain" information available for 3NKF)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Peptidase_CD (53)

Family: Peptidase_C14 (53)

Homo sapiens (Human) (51)

1a	Peptidase_C14-3nkfD01	D:45-288
1b	Peptidase_C14-3nkfD02	D:45-288
1c	Peptidase_C14-3nkfD03	D:45-288
1d	Peptidase_C14-3nkfD04	D:45-288

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (CASP6_HUMAN | P55212)

molecular function
	GO:0004197	cysteine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile, and contributing to the apoptotic process.
	GO:0008234	cysteine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0004175	endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0006921	cellular component disassembly involved in execution phase of apoptosis	The breakdown of structures such as organelles, proteins, or other macromolecular structures during apoptosis.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3nkf)

	Sites
(no "Sites" information available for 3nkf)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3nkf)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3nkf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CASP6_HUMAN \| P55212
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.4.22.59
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CASP6_HUMAN \| P55212
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (4, 16)

Exons (5, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File