Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MECHANISTIC AND STRUCTURAL UNDERSTANDING OF UNCOMPETITIVE INHIBITORS OF CASPASE-6
 
Authors :  J. M. Murray, M. Steffek
Date :  05 Nov 12  (Deposition) - 20 Mar 13  (Release) - 20 Mar 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.07
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Caspase-6, Active, Veid, Uncompetitive Inhibition, Ternary Complex, Caspase, Protease, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. E. Heise, J. Murray, K. E. Augustyn, B. Bravo, P. Chugha, F. Cohen, A. M. Giannetti, P. Gibbons, R. N. Hannoush, B. R. Hearn, P. Jaishankar C. Q. Ly, K. Shah, K. Stanger, M. Steffek, Y. Tang, X. Zhao, J. W. Lewcock A. R. Renslo, J. Flygare, M. R. Arkin
Mechanistic And Structural Understanding Of Uncompetitive Inhibitors Of Caspase-6.
Plos One V. 7 50864 2012
PubMed-ID: 23227217  |  Reference-DOI: 10.1371/JOURNAL.PONE.0050864

(-) Compounds

Molecule 1 - CASPASE-6
    ChainsA, B
    EC Number3.4.22.59
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneCASP6, MCH2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCASP-6, APOPTOTIC PROTEASE MCH-2, CASPASE-6 SUBUNIT P18, CASPASE-6 SUBUNIT P11
 
Molecule 2 - VEID INHIBITOR
    ChainsC, D
    EngineeredYES
    SyntheticYES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric/Biological Unit (3, 6)
No.NameCountTypeFull Name
14H02Mod. Amino Acid(3S)-3-AMINO-4-OXO-5-(2,3,5,6-TETRAFLUOROPHENOXY)PENTANOIC ACID
24HV2Ligand/IonN-[(2R)-1-(3-CYANOPHENYL)-3-HYDROXYPROPAN-2-YL]-5-(3,4-DIMETHOXYPHENYL)FURAN-3-CARBOXAMIDE
3PHQ2Mod. Amino AcidBENZYL CHLOROCARBONATE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU B:61 , HIS B:121 , GLY B:122 , TYR B:128 , HIS B:168 , HIS B:219 , CYS B:264 , LYS B:265 , ALA B:269 , VAL D:2 , GLU D:3 , ILE D:4 , 4H0 D:5BINDING SITE FOR RESIDUE 4HV B 401
2AC2SOFTWARELEU A:61 , PRO A:62 , HIS A:121 , GLY A:122 , HIS A:168 , HIS A:219 , CYS A:264 , VAL C:2 , GLU C:3 , ILE C:4 , HOH C:504BINDING SITE FOR RESIDUE 4HV A 401
3AC3SOFTWAREARG A:64 , ARG A:65 , SER A:120 , HIS A:121 , GLY A:122 , GLN A:161 , ALA A:162 , CYS A:163 , TYR A:217 , SER A:218 , HIS A:219 , ARG A:220 , THR A:222 , PHE A:263 , CYS A:264 , LYS A:265 , 4HV A:401 , HOH A:543 , HOH A:610 , HOH C:501 , HOH C:502 , HOH C:503BINDING SITE FOR CHAIN C OF VEID INHIBITOR
4AC4SOFTWAREARG B:64 , ARG B:65 , SER B:120 , HIS B:121 , GLY B:122 , GLN B:161 , CYS B:163 , TYR B:217 , SER B:218 , HIS B:219 , ARG B:220 , THR B:222 , PHE B:263 , CYS B:264 , LYS B:265 , 4HV B:401 , HOH B:522 , HOH D:101BINDING SITE FOR CHAIN D OF VEID INHIBITOR

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4HVA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4HVA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4HVA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4HVA)

(-) Exons   (0, 0)

(no "Exon" information available for 4HVA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:238
                                                                                                                                                                                                                                                                              
               SCOP domains d4hvaa_ A: automated matches                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeee....hhhhh.....hhhhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhhh.......eeeeee..ee..eee....eeehhhhhhhhh...hhhhh...eeeeee.........ee....ee....eeeee.........ee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh......hhhhh......eeee........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4hva A  31 FDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK 291
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170   ||  203       213       223       233       243       253       263       273       283        
                                                                                                                                                                         174|                                                                                             
                                                                                                                                                                          198                                                                                             

Chain B from PDB  Type:PROTEIN  Length:241
                                                                                                                                                                                                                                                                                 
               SCOP domains d4hvab_ B: automated matches                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeeeee....hhhhh.....hhhhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhhh.......eeeeee..ee..eee....eeehhhhhhh.....hhhhh...eeeeee.........ee......ee....eeeee.........ee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhh........hhhhh......eeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4hva B  30 MFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPK 291
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169     ||200       210       220       230       240       250       260       270       280       290 
                                                                                                                                                                           175|                                                                                              
                                                                                                                                                                            197                                                                                              

Chain C from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4hva C   1 xVEIx   5
                            |   |
                            1-PHQ
                                5-4H0

Chain D from PDB  Type:PROTEIN  Length:5
                                     
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4hva D   1 xVEIx   5
                            |   |
                            |   |
                            1-PHQ
                                5-4H0

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4HVA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4HVA)

(-) Gene Ontology  (16, 16)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    4H0  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    4HV  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PHQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4hva)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4hva
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CASP6_HUMAN | P55212
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.22.59
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CASP6_HUMAN | P55212
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CASP6_HUMAN | P552121mi9 2wdp 3k7e 3nkf 3nr2 3od5 3p45 3p4u 3qnw 3s70 3s8e 3v6l 3v6m 4ejf 4fxo 4iyr 4n5d 4n6g 4n7j 4n7m 4nbk 4nbl 4nbn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4HVA)