Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  HUMAN SUMO E1~SUMO1-AMP TETRAHEDRAL INTERMEDIATE MIMIC
 
Authors :  C. D. Lima
Date :  05 Dec 09  (Deposition) - 16 Feb 10  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.61
Chains :  Asym./Biol. Unit :  A,B,D
Keywords :  E1, Sumo, Ubiquitin, Thioester, Adenylation, Inhibitor, Tetrahedral Intermediate, Ligase, Nucleus, Phosphoprotein, Ubl Conjugation Pathway, Atp-Binding, Nucleotide-Binding, Isopeptide Bond, Membrane (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. K. Olsen, A. D. Capili, X. Lu, D. S. Tan, C. D. Lima
Active Site Remodelling Accompanies Thioester Bond Formatio In The Sumo E1.
Nature V. 463 906 2010
PubMed-ID: 20164921  |  Reference-DOI: 10.1038/NATURE08765

(-) Compounds

Molecule 1 - SUMO-ACTIVATING ENZYME SUBUNIT 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-15B
    Expression System StrainBL21 DE3 CP RIL
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneAOS1, SAE1, SUA1, UBLE1A
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymUBIQUITIN-LIKE 1-ACTIVATING ENZYME E1A
 
Molecule 2 - SUMO-ACTIVATING ENZYME SUBUNIT 2
    ChainsB
    EC Number6.3.2.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPSMT3
    Expression System StrainBL21 DE3 CP RIL
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneHRIHFB2115, SAE2, UBA2, UBLE1B
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymUBIQUITIN-LIKE 1-ACTIVATING ENZYME E1B, ANTHRACYCLINE- ASSOCIATED RESISTANCE ARX
 
Molecule 3 - SMALL UBIQUITIN-RELATED MODIFIER 1
    ChainsD
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28B
    Expression System StrainBL21 DE3 CP RIL
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 1-96
    GeneOK/SW-CL.43, SMT3C, SMT3H3, SUMO1, UBL1
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymSUMO-1, SENTRIN, UBIQUITIN-LIKE PROTEIN SMT3C, SMT3 HOMOLOG 3, UBIQUITIN-HOMOLOGY DOMAIN PROTEIN PIC1, UBIQUITIN-LIKE PROTEIN UBL1, GAP-MODIFYING PROTEIN 1, GMP1

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric/Biological Unit (3, 5)
No.NameCountTypeFull Name
1EDO3Ligand/Ion1,2-ETHANEDIOL
2VMX1Ligand/Ion5'-{[(3-AMINOPROPYL)SULFONYL]AMINO}-5'-DEOXYADENOSINE
3ZN1Ligand/IonZINC ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:159 , GLY A:163 , TYR A:164 , ASP A:239 , LEU A:242 , LEU A:243 , HOH A:414BINDING SITE FOR RESIDUE EDO A 347
2AC2SOFTWAREARG A:83 , GLU A:97 , ARG A:98 , GLN B:82BINDING SITE FOR RESIDUE EDO A 348
3AC3SOFTWARECYS B:158 , CYS B:161 , CYS B:441 , CYS B:444BINDING SITE FOR RESIDUE ZN B 550
4AC4SOFTWAREGLY B:24 , GLY B:27 , ILE B:28 , ASP B:48 , LEU B:49 , ASP B:50 , LYS B:72 , ASP B:94 , SER B:95 , ILE B:96 , ALA B:115 , LEU B:116 , ASP B:117 , ASN B:118 , THR B:141 , CYS B:173 , THR B:174 , ARG B:176 , HOH B:614 , GLY D:96BINDING SITE FOR RESIDUE VMX D 97
5AC5SOFTWAREARG A:235 , ARG B:425 , HOH B:651 , GLU D:67BINDING SITE FOR RESIDUE EDO D 98

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3KYD)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3KYD)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3KYD)

(-) PROSITE Motifs  (3, 3)

Asymmetric/Biological Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.SUMO1_HUMAN20-97  1D:20-96
2UBIQUITIN_ACTIVAT_2PS00865 Ubiquitin-activating enzyme active site.SAE2_HUMAN171-179  1B:171-179
3UBIQUITIN_ACTIVAT_1PS00536 Ubiquitin-activating enzyme signature 1.SAE2_HUMAN404-412  1B:404-412

(-) Exons   (29, 29)

Asymmetric/Biological Unit (29, 29)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002465481ENSE00000862687chr19:34919268-34919475208SAE2_HUMAN1-46461B:4-4643
1.2ENST000002465482ENSE00000862688chr19:34921481-3492156484SAE2_HUMAN47-74281B:47-7428
1.3ENST000002465483ENSE00000862689chr19:34922766-3492283671SAE2_HUMAN75-98241B:75-9824
1.4ENST000002465484ENSE00000862690chr19:34924253-3492431765SAE2_HUMAN98-120231B:98-12023
1.5ENST000002465485ENSE00000862691chr19:34925773-34925873101SAE2_HUMAN120-153341B:120-15334
1.6ENST000002465486ENSE00000862692chr19:34929550-34929671122SAE2_HUMAN154-194411B:154-19441
1.7ENST000002465487ENSE00000862693chr19:34934749-3493481668SAE2_HUMAN194-217241B:194-1974
1.8ENST000002465488ENSE00000862694chr19:34935905-34936026122SAE2_HUMAN217-257411B:240-25718
1.9ENST000002465489ENSE00000862695chr19:34941170-34941269100SAE2_HUMAN258-291341B:258-29033
1.10ENST0000024654810ENSE00000862696chr19:34942886-34943052167SAE2_HUMAN291-346561B:309-346 (gaps)38
1.11ENST0000024654811ENSE00000862697chr19:34945165-3494525894SAE2_HUMAN347-378321B:347-37832
1.12ENST0000024654812ENSE00000862698chr19:34945349-34945461113SAE2_HUMAN378-415381B:378-41538
1.13ENST0000024654813ENSE00000862699chr19:34949674-34949829156SAE2_HUMAN416-467521B:416-46752
1.14ENST0000024654814ENSE00000862700chr19:34951375-3495147197SAE2_HUMAN468-500331B:468-50033
1.15ENST0000024654815ENSE00000862701chr19:34954931-34955036106SAE2_HUMAN500-535361B:500-53536
1.16ENST0000024654816ENSE00000862702chr19:34957783-34957919137SAE2_HUMAN535-581471B:535-54814
1.17ENST0000024654817ENSE00000862703chr19:34959945-34960795851SAE2_HUMAN581-640600--

2.1bENST000002702251bENSE00001602790chr19:47634144-47634285142SAE1_HUMAN1-33331A:25-339
2.2ENST000002702252ENSE00000953004chr19:47646751-47646862112SAE1_HUMAN33-70381A:33-7038
2.3ENST000002702253ENSE00000953005chr19:47653459-47653632174SAE1_HUMAN71-128581A:71-12858
2.4ENST000002702254ENSE00000953006chr19:47656155-47656297143SAE1_HUMAN129-176481A:129-17648
2.5ENST000002702255ENSE00000953007chr19:47658371-47658470100SAE1_HUMAN176-209341A:176-209 (gaps)34
2.6ENST000002702256ENSE00000953008chr19:47673075-47673180106SAE1_HUMAN210-245361A:210-24536
2.8ENST000002702258ENSE00001698339chr19:47700490-47700634145SAE1_HUMAN245-293491A:245-29349
2.9ENST000002702259ENSE00001799877chr19:47706928-4770699770SAE1_HUMAN293-316241A:293-31624
2.10bENST0000027022510bENSE00001604339chr19:47712416-477135321117SAE1_HUMAN317-346301A:317-34529

3.1aENST000003922461aENSE00001771214chr2:203103331-203103163169SUMO1_HUMAN1-440--
3.5ENST000003922465ENSE00001634753chr2:203084829-20308475575SUMO1_HUMAN5-29251D:20-2910
3.6bENST000003922466bENSE00001733147chr2:203079157-20307908078SUMO1_HUMAN30-55261D:30-5526
3.7bENST000003922467bENSE00001777388chr2:203075529-20307545872SUMO1_HUMAN56-79241D:56-7924
3.9jENST000003922469jENSE00001390654chr2:203072044-2030709031142SUMO1_HUMAN80-101221D:80-9617

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:301
 aligned with SAE1_HUMAN | Q9UBE0 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:321
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344 
           SAE1_HUMAN    25 LWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP 345
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------ThiF-3kydA01 A:35-168                                                                                                                 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh..eeeee..hhhhhhhhhhhhhhh..eeeee.........................hhhhhhhhhhh....eeeee..hhhhhhhhhhh...eeee...hhhhhhhhhhhhhhh..eeeeeeee..eeeeeee..eeeeeeee..ee.--------------------.eeeeeeee..hhhhhhh....hhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......eeeee....eeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.1b-------------------------------------Exon 2.3  PDB: A:71-128 UniProt: 71-128                   Exon 2.4  PDB: A:129-176 UniProt: 129-176       ---------------------------------Exon 2.6  PDB: A:210-245            -----------------------------------------------Exon 2.9  PDB: A:293-316Exon 2.10b  PDB: A:317-345    Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.2  PDB: A:33-70 UniProt: 33-70 ---------------------------------------------------------------------------------------------------------Exon 2.5  PDB: A:176-209 (gaps)   -----------------------------------Exon 2.8  PDB: A:245-293 UniProt: 245-293        ---------------------------------------------------- Transcript 2 (2)
                 3kyd A  25 LWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAK--------------------TTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP 345
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174        |-         -       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344 
                                                                                                                                                                                        183                  204                                                                                                                                             

Chain B from PDB  Type:PROTEIN  Length:477
 aligned with SAE2_HUMAN | Q9UBT2 from UniProtKB/Swiss-Prot  Length:640

    Alignment length:545
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543     
           SAE2_HUMAN     4 SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPDRADPEAAWEPTEAEARARASNEDGDIKRISTKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG 548
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------ThiF-3kydB01 B:16-151                                                                                                                   --UBA_e1_thiolCys-3kydB03 B:154-197           ---------------------------------------------------------------------------------------------------------------------------------------------------UBACT-3kydB02 B:345-409                                          ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhh.eeee..hhhhhhhhhhhhhhh..eeeee................hhhhh..hhhhhhhhhhhh.....eeeee.........hhhhhh...eeee...hhhhhhhhhhhhhhhh..eeeeeee..eeeeeee..................ee..........hhhhhhhhhhhhh...------------------------------------------...hhhhhh.....hhhhhhhhhhhhhh...............hhhhhhhh------------------.....hhhhhhhhhhhhhhhhhhhhhh.--------...hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhee..hhhhhhhhhhhhhhhhhhhhh.hhhhh.eeee........eeeeee................eeeeee.....hhhhhhhhh.........eeeee......eee......hhhhh..hhhhhh.....eeeeee....eeeeeeeee.........eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------UBIQUITIN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------UBIQUITIN---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:4-46 UniProt: 1-46        Exon 1.2  PDB: B:47-74      Exon 1.3  PDB: B:75-98  ---------------------Exon 1.5  PDB: B:120-153          Exon 1.6  PDB: B:154-194 UniProt: 154-194----------------------Exon 1.8  PDB: B:240-257 UniProt: 217-257---------------------------------Exon 1.10  PDB: B:309-346 (gaps) UniProt: 291-346       Exon 1.11  PDB: B:347-378       -------------------------------------Exon 1.13  PDB: B:416-467 UniProt: 416-467          Exon 1.14  PDB: B:468-500        ----------------------------------Exon 1.16      Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------Exon 1.4  PDB: B:98-120-------------------------------------------------------------------------Exon 1.7  PDB: B:194-197----------------------------------------Exon 1.9  PDB: B:258-290          --------------------------------------------------------------------------------------Exon 1.12  PDB: B:378-415             ------------------------------------------------------------------------------------Exon 1.15  PDB: B:500-535           ------------- Transcript 1 (2)
                 3kyd B   4 SRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLF------------------------------------------TKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQ------------------DQQVLDVKSYARLFSKSIETLRVHLAEK--------DKDDPSAMDFVTSAANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVAPDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSEDLGKDVEFEVVG 548
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193   |     -         -         -         -      |243       253       263       273       283      |  -         -     | 313       323       333  |      - |     353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543     
                                                                                                                                                                                                                           197                                        240                                               290                309                        336      345                                                                                                                                                                                                           

Chain D from PDB  Type:PROTEIN  Length:77
 aligned with SUMO1_HUMAN | P63165 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:77
                                    29        39        49        59        69        79        89       
          SUMO1_HUMAN    20 EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG  96
               SCOP domains d3kydd_ D: SUMO-1 (smt3 homologue)                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains --Rad60-SLD-3kydD01 D:22-92                                              ---- Pfam domains
         Sec.struct. author .eeeeeee.....eeeeeee....hhhhhhhhhhhhh.....eeeee..ee................eeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: D:20-96 UniProt: 20-97                                      PROSITE
               Transcript 3 Exon 3.5  Exon 3.6b  PDB: D:30-55   Exon 3.7b  PDB: D:56-79 Exon 3.9j         Transcript 3
                 3kyd D  20 EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQCG  96
                                    29        39        49        59        69        79        89       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3KYD)

(-) Pfam Domains  (4, 5)

Asymmetric/Biological Unit
(-)
Family: ThiF (14)
(-)
Clan: Ubiquitin (279)

(-) Gene Ontology  (64, 82)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (SAE1_HUMAN | Q9UBE0)
molecular function
    GO:0043008    ATP-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules) using energy from the hydrolysis of ATP.
    GO:0019948    SUMO activating enzyme activity    Catalysis of the activation of the proteolytically processed small ubiquitin-related modifier SUMO, through the formation of an ATP-dependent high-energy thiolester bond.
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0008022    protein C-terminus binding    Interacting selectively and non-covalently with a protein C-terminus, the end of any peptide chain at which the 1-carboxy function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0008641    small protein activating enzyme activity    Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
    GO:0004839    ubiquitin activating enzyme activity    Catalysis of the reaction: E1 + ubiquitin + ATP--> E1-ubiquitin + AMP + PPi, where the E1-ubiquitin linkage is a thioester bond between the C-terminal glycine of Ub and a sulfhydryl side group of an E1 cysteine residue. This is the first step in a cascade of reactions in which ubiquitin is ultimately added to a protein substrate.
biological process
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0043085    positive regulation of catalytic activity    Any process that activates or increases the activity of an enzyme.
    GO:1903955    positive regulation of protein targeting to mitochondrion    Any process that activates or increases the frequency, rate or extent of protein targeting to mitochondrion.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0007346    regulation of mitotic cell cycle    Any process that modulates the rate or extent of progress through the mitotic cell cycle.
cellular component
    GO:0031510    SUMO activating enzyme complex    A conserved heterodimeric complex with SUMO activating enzyme activity.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B   (SAE2_HUMAN | Q9UBT2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0019948    SUMO activating enzyme activity    Catalysis of the activation of the proteolytically processed small ubiquitin-related modifier SUMO, through the formation of an ATP-dependent high-energy thiolester bond.
    GO:0008047    enzyme activator activity    Binds to and increases the activity of an enzyme.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0008641    small protein activating enzyme activity    Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
    GO:0043085    positive regulation of catalytic activity    Any process that activates or increases the activity of an enzyme.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
cellular component
    GO:0031510    SUMO activating enzyme complex    A conserved heterodimeric complex with SUMO activating enzyme activity.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain D   (SUMO1_HUMAN | P63165)
molecular function
    GO:0044325    ion channel binding    Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
    GO:0015459    potassium channel regulator activity    Modulates potassium channel activity via direct interaction interaction with a potassium channel (binding or modification).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0031386    protein tag    A molecular function exhibited by a protein that is covalently attached (AKA tagged or conjugated) to another protein where it acts as a marker, recognized by the cellular apparatus to target the tagged protein for some cellular process such as modification, sequestration, transport or degradation.
    GO:0008134    transcription factor binding    Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0030578    PML body organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of PML bodies, a class of nuclear body; they react against SP100 auto-antibodies (PML = promyelocytic leukemia).
    GO:0006303    double-strand break repair via nonhomologous end joining    The repair of a double-strand break in DNA in which the two broken ends are rejoined with little or no sequence complementarity. Information at the DNA ends may be lost due to the modification of broken DNA ends. This term covers instances of separate pathways, called classical (or canonical) and alternative nonhomologous end joining (C-NHEJ and A-NHEJ). These in turn may further branch into sub-pathways, but evidence is still unclear.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0043392    negative regulation of DNA binding    Any process that stops or reduces the frequency, rate or extent of DNA binding. DNA binding is any process in which a gene product interacts selectively with DNA (deoxyribonucleic acid).
    GO:0045759    negative regulation of action potential    Any process that stops, prevents, or reduces the frequency, rate or extent of action potential creation, propagation or termination. This typically occurs via modulation of the activity or expression of voltage-gated ion channels.
    GO:1902260    negative regulation of delayed rectifier potassium channel activity    Any process that stops, prevents or reduces the frequency, rate or extent of delayed rectifier potassium channel activity.
    GO:0043433    negative regulation of sequence-specific DNA binding transcription factor activity    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0060021    palate development    The biological process whose specific outcome is the progression of the palate from an initial condition to its mature state. This process begins with the formation of the structure and ends with the mature structure. The palate is the partition that separates the nasal and oral cavities.
    GO:1901896    positive regulation of calcium-transporting ATPase activity    Any process that activates or increases the frequency, rate or extent of calcium-transporting ATPase activity.
    GO:0032436    positive regulation of proteasomal ubiquitin-dependent protein catabolic process    Any process that activates or increases the frequency, rate or extent of the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0031334    positive regulation of protein complex assembly    Any process that activates or increases the frequency, rate or extent of protein complex assembly.
    GO:0090204    protein localization to nuclear pore    A process in which a protein is transported to, or maintained in, a nuclear pore.
    GO:0050821    protein stabilization    Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
    GO:0016925    protein sumoylation    The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
    GO:1903169    regulation of calcium ion transmembrane transport    Any process that modulates the frequency, rate or extent of calcium ion transmembrane transport.
    GO:0086004    regulation of cardiac muscle cell contraction    Any process that modulates the frequency, rate or extent of cardiac muscle cell contraction.
    GO:0060334    regulation of interferon-gamma-mediated signaling pathway    Any process that modulates the rate, frequency or extent of the series of molecular events generated as a consequence of interferon-gamma binding to a cell surface receptor.
    GO:0032880    regulation of protein localization    Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
    GO:0031647    regulation of protein stability    Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0016605    PML body    A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
    GO:0001741    XY body    A structure found in a male mammalian spermatocyte containing an unpaired X chromosome that has become densely heterochromatic, silenced and localized at the nuclear periphery.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0030425    dendrite    A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
    GO:0001650    fibrillar center    A structure found most metazoan nucleoli, but not usually found in lower eukaryotes; surrounded by the dense fibrillar component; the zone of transcription from multiple copies of the pre-rRNA genes is in the border region between these two structures.
    GO:0000792    heterochromatin    A compact and highly condensed form of chromatin.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0016604    nuclear body    Extra-nucleolar nuclear domains usually visualized by confocal microscopy and fluorescent antibodies to specific proteins.
    GO:0031965    nuclear membrane    Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0016607    nuclear speck    A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045202    synapse    The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    VMX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3kyd)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3kyd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SAE1_HUMAN | Q9UBE0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SAE2_HUMAN | Q9UBT2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SUMO1_HUMAN | P63165
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.2.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SAE1_HUMAN | Q9UBE0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SAE2_HUMAN | Q9UBT2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SUMO1_HUMAN | P63165
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SAE1_HUMAN | Q9UBE01y8q 1y8r 3kyc
        SAE2_HUMAN | Q9UBT21y8q 1y8r 2px9 3kyc 4w5v 5fq2
        SUMO1_HUMAN | P631651a5r 1tgz 1wyw 1y8r 1z5s 2asq 2bf8 2g4d 2io2 2iy0 2iy1 2kqs 2las 2mw5 2n1a 2n1v 2pe6 2uyz 2vrr 3kyc 3rzw 3uip 4wjn 4wjo 4wjp 4wjq 5aek 5b7a 5elj 5ghd

(-) Related Entries Specified in the PDB File

3kyc