|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3IVV) |
Sites (0, 0)| (no "Site" information available for 3IVV) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3IVV) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3IVV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3IVV) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (5, 5)
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:140 aligned with SPOP_HUMAN | O43791 from UniProtKB/Swiss-Prot Length:374 Alignment length:151 24 34 44 54 64 74 84 94 104 114 124 134 144 154 164 SPOP_HUMAN 15 SGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ 165 SCOP domains d3 ivva_ A: Speckle-type poz protein SPOP SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------MATH PDB: A:31-161 UniProt: 31-161 ---- PROSITE Transcript 1 (1) Exon 1.8d Exon 1.10d PDB: A:28-67 UniProt: 27-67 --------------------------------------------------Exon 1.13b PDB: A:118-160 UniProt: 118-1601.16c Transcript 1 (1) Transcript 1 (2) ----------------------------------------------------Exon 1.12c PDB: A:67-118 UniProt: 67-118 ----------------------------------------------- Transcript 1 (2) 3ivv A 26 SG-----------KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ 165 | - | 34 44 54 64 74 84 94 104 114 124 134 144 154 164 | 28 27
Chain D from PDB Type:PROTEIN Length:10
SCOP domains ---------- SCOP domains
CATH domains ---------- CATH domains
Pfam domains ---------- Pfam domains
SAPs(SNPs) ---------- SAPs(SNPs)
PROSITE ---------- PROSITE
Transcript ---------- Transcript
3ivv D 96 DEVTSTTSSS 105
105
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3IVV) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3IVV) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (SPOP_HUMAN | O43791)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|