3I0F - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF GTB C80S/C196S + UDP + H ANTIGEN

Authors :   B. Schuman, M. Persson, R. C. Landry, R. Polakowski, J. T. Weadge, N. O. L S. Borisova, M. M. Palcic, S. V. Evans

Date :   25 Jun 09 (Deposition) - 11 Aug 10 (Release) - 06 Oct 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.56

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Gtb, Glycosyltransferase, Abo Blood Group, Retaining, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. Schuman, M. Persson, R. C. Landry, R. Polakowski, J. T. Weadge, N. O. Seto, S. N. Borisova, M. M. Palcic, S. V. Evans
Cysteine-To-Serine Mutants Dramatically Reorder The Active Site Of Human Abo(H) Blood Group B Glycosyltransferase Without Affecting Activity: Structural Insights Into Cooperative Substrate Binding
J. Mol. Biol. V. 402 399 2010
PubMed-ID: 20655926 | Reference-DOI: 10.1016/J.JMB.2010.07.036

Molecule 1 - ABO GLYCOSYLTRANSFERASE
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PCW(DELTA)LAC
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 59 TO 344
	Gene	:	GTB
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1
Asymmetric Unit	:	A
Biological Unit 1 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (5, 5)

No.	Name	Count	Type	Full Name
1	BHG	1	Ligand/Ion	2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
2	FUC	1	Ligand/Ion	ALPHA-L-FUCOSE
3	MN	1	Ligand/Ion	MANGANESE (II) ION
4	U	1	Ligand/Ion	URIDINE-5'-MONOPHOSPHATE
5	UDP	1	Ligand/Ion	URIDINE-5'-DIPHOSPHATE

Biological Unit 1 (3, 6)

No.	Name	Count	Type	Full Name
1	BHG	2	Ligand/Ion	2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
2	FUC	2	Ligand/Ion	ALPHA-L-FUCOSE
3	MN	-1	Ligand/Ion	MANGANESE (II) ION
4	U	-1	Ligand/Ion	URIDINE-5'-MONOPHOSPHATE
5	UDP	2	Ligand/Ion	URIDINE-5'-DIPHOSPHATE

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:57 , PRO A:72 , SER A:80 , LEU A:85 , PRO A:89 , GLY A:98 , THR A:99 , PHE A:100 , ASN A:101 , HOH A:363 , HOH A:370 , HOH A:412 , HOH A:421 , HOH A:482 , HOH A:499 , HOH A:531	BINDING SITE FOR RESIDUE U A 1
2	AC2	SOFTWARE	HOH A:22 , HIS A:233 , SER A:235 , PHE A:236 , THR A:245 , TRP A:300 , GLU A:303 , FUC A:356 , UDP A:357 , HOH A:362 , HOH A:382	BINDING SITE FOR RESIDUE BHG A 400
3	AC3	SOFTWARE	HOH A:55 , MET A:266 , ASP A:326 , UDP A:357 , HOH A:382 , HOH A:385 , HOH A:392 , BHG A:400 , HOH A:575	BINDING SITE FOR RESIDUE FUC A 356
4	AC4	SOFTWARE	MN A:2 , HOH A:20 , HOH A:68 , PHE A:121 , ALA A:122 , ILE A:123 , TYR A:126 , ARG A:188 , ASP A:211 , VAL A:212 , ASP A:213 , LYS A:346 , FUC A:356 , BHG A:400 , HOH A:446 , HOH A:448 , HOH A:470 , HOH A:525 , HOH A:548 , HOH A:551	BINDING SITE FOR RESIDUE UDP A 357
5	AC5	SOFTWARE	HOH A:30 , ASP A:211 , ASP A:213 , UDP A:357	BINDING SITE FOR RESIDUE MN A 2

(no "SS Bond" information available for 3I0F)

Asymmetric Unit

No.	Residues
1	Val A:175	-	Gly A:176

Asymmetric Unit (21, 21)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019150	P	74	S	BGAT_HUMAN	Polymorphism	512770	A	P	74	S
02	UniProt	VAR_003409	P	156	L	BGAT_HUMAN	Polymorphism	1053878	A	P	156	L
03	UniProt	VAR_019151	R	161	H	BGAT_HUMAN	Polymorphism	8176738	A	R	161	H
04	UniProt	VAR_036738	T	163	M	BGAT_HUMAN	Polymorphism	55756402	A	T	163	M
05	UniProt	VAR_003410	R	176	G	BGAT_HUMAN	Polymorphism	7853989	A	G	176	G
06	UniProt	VAR_036739	R	198	W	BGAT_HUMAN	Polymorphism	56223957	A	R	198	W
07	UniProt	VAR_019152	R	199	C	BGAT_HUMAN	Polymorphism	8176739	A	R	199	C
08	UniProt	VAR_036740	M	214	R	BGAT_HUMAN	Polymorphism	55827808	A	M	214	R
09	UniProt	VAR_019153	F	216	I	BGAT_HUMAN	Polymorphism	8176740	A	F	216	I
10	UniProt	VAR_036741	E	223	D	BGAT_HUMAN	Polymorphism	---	A	E	223	D
11	UniProt	VAR_055227	G	230	R	BGAT_HUMAN	Unclassified	---	A	G	230	R
12	UniProt	VAR_072628	P	234	A	BGAT_HUMAN	Polymorphism	---	A	P	234	A
13	UniProt	VAR_003411	G	235	S	BGAT_HUMAN	Polymorphism	8176743	A	S	235	S
14	UniProt	VAR_033540	P	257	L	BGAT_HUMAN	Polymorphism	8176745	A	P	257	L
15	UniProt	VAR_003412	L	266	M	BGAT_HUMAN	Polymorphism	8176746	A	M	266	M
16	UniProt	VAR_003413	G	268	A	BGAT_HUMAN	Polymorphism	8176747	A	A	268	A
17	UniProt	VAR_033541	G	268	R	BGAT_HUMAN	Polymorphism	8176747	A	A	268	R
18	UniProt	VAR_019154	V	277	M	BGAT_HUMAN	Polymorphism	8176748	A	V	277	M
19	UniProt	VAR_036742	M	288	R	BGAT_HUMAN	Polymorphism	---	A	M	288	R
20	UniProt	VAR_036743	D	291	N	BGAT_HUMAN	Polymorphism	---	A	D	291	N
21	UniProt	VAR_036744	K	346	M	BGAT_HUMAN	Polymorphism	---	A	K	346	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (21, 42)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_019150	P	74	S	BGAT_HUMAN	Polymorphism	512770	A	P	74	S
02	UniProt	VAR_003409	P	156	L	BGAT_HUMAN	Polymorphism	1053878	A	P	156	L
03	UniProt	VAR_019151	R	161	H	BGAT_HUMAN	Polymorphism	8176738	A	R	161	H
04	UniProt	VAR_036738	T	163	M	BGAT_HUMAN	Polymorphism	55756402	A	T	163	M
05	UniProt	VAR_003410	R	176	G	BGAT_HUMAN	Polymorphism	7853989	A	G	176	G
06	UniProt	VAR_036739	R	198	W	BGAT_HUMAN	Polymorphism	56223957	A	R	198	W
07	UniProt	VAR_019152	R	199	C	BGAT_HUMAN	Polymorphism	8176739	A	R	199	C
08	UniProt	VAR_036740	M	214	R	BGAT_HUMAN	Polymorphism	55827808	A	M	214	R
09	UniProt	VAR_019153	F	216	I	BGAT_HUMAN	Polymorphism	8176740	A	F	216	I
10	UniProt	VAR_036741	E	223	D	BGAT_HUMAN	Polymorphism	---	A	E	223	D
11	UniProt	VAR_055227	G	230	R	BGAT_HUMAN	Unclassified	---	A	G	230	R
12	UniProt	VAR_072628	P	234	A	BGAT_HUMAN	Polymorphism	---	A	P	234	A
13	UniProt	VAR_003411	G	235	S	BGAT_HUMAN	Polymorphism	8176743	A	S	235	S
14	UniProt	VAR_033540	P	257	L	BGAT_HUMAN	Polymorphism	8176745	A	P	257	L
15	UniProt	VAR_003412	L	266	M	BGAT_HUMAN	Polymorphism	8176746	A	M	266	M
16	UniProt	VAR_003413	G	268	A	BGAT_HUMAN	Polymorphism	8176747	A	A	268	A
17	UniProt	VAR_033541	G	268	R	BGAT_HUMAN	Polymorphism	8176747	A	A	268	R
18	UniProt	VAR_019154	V	277	M	BGAT_HUMAN	Polymorphism	8176748	A	V	277	M
19	UniProt	VAR_036742	M	288	R	BGAT_HUMAN	Polymorphism	---	A	M	288	R
20	UniProt	VAR_036743	D	291	N	BGAT_HUMAN	Polymorphism	---	A	D	291	N
21	UniProt	VAR_036744	K	346	M	BGAT_HUMAN	Polymorphism	---	A	K	346	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3I0F)

(no "Exon" information available for 3I0F)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:268
 aligned with BGAT_HUMAN | P16442 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:277
                                    80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       
           BGAT_HUMAN    71 YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN 347
               SCOP domains d3i0fa_ A: automated matches                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................ee.....hhhhhhhhhhhh..eeeeeeeehhhhhhhhhhhhhhhhhhh....eeeeeeee.hhhhh........eeeeeee..---------hhhhhhhhhhhhhhhhh...eeeee...eee....hhhhh..eeee.....................................eeeeehhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh...eee.hhhh.hhhhhh.........eee.... Sec.struct. author
             SAPs(SNPs) (1) ---S---------------------------------------------------------------------------------L----H-M------------G---------------------WC--------------R-I------D------R---AS---------------------L--------M-A--------M----------R--N------------------------------------------------------M- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3i0f A  71 YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVG---------MRRMEMISDFSERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN 347
                                    80        90       100       110       120       130       140       150       160       170     |   -     | 190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       
                                                                                                                                   176       186

Chain A from PDB  Type:PROTEIN  Length:268
 aligned with Q70V26_HUMAN | Q70V26 from UniProtKB/TrEMBL  Length:344

    Alignment length:277
                                    70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       
         Q70V26_HUMAN    61 YPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPMN 337
               SCOP domains d3i0fa_ A: automated matches                                                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................ee.....hhhhhhhhhhhh..eeeeeeeehhhhhhhhhhhhhhhhhhh....eeeeeeee.hhhhh........eeeeeee..---------hhhhhhhhhhhhhhhhh...eeeee...eee....hhhhh..eeee.....................................eeeeehhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh...eee.hhhh.hhhhhh.........eee.... Sec.struct. author
             SAPs(SNPs) (1) ---S---------------------------------------------------------------------------------L----H-M------------G---------------------WC--------------R-I------D------R---AS---------------------L--------M-A--------M----------R--N------------------------------------------------------M- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3i0f A  71 YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVG---------MRRMEMISDFSERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKN 347
                                    80        90       100       110       120       130       140       150       160       170     |   -     | 190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       
                                                                                                                                   176       186

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Nucleotide-diphospho-sugar transferases (408)

Superfamily: Nucleotide-diphospho-sugar transferases (408)

Family: alpha-1,3-galactosyltransferase-like (125)

Protein domain: automated matches (38)

Human (Homo sapiens) [TaxId: 9606] (36)

d3i0fa_

(no "CATH Domain" information available for 3I0F)

(no "Pfam Domain" information available for 3I0F)

Asymmetric Unit(hide GO term definitions)

Chain A (BGAT_HUMAN | P16442)

molecular function
	GO:0004381	fucosylgalactoside 3-alpha-galactosyltransferase activity	Catalysis of the reaction: UDP-galactose + glycoprotein-alpha-L-fucosyl-(1,2)-D-galactose = UDP + glycoprotein-alpha-D-galactosyl-(1,3)-(alpha-L-fucosyl-(1,2))-D-galactose.
	GO:0004380	glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase activity	Catalysis of the reaction: UDP-N-acetyl-D-galactosamine + glycoprotein-alpha-L-fucosyl-(1,2)-D-galactose = UDP + glycoprotein-N-acetyl-alpha-D-galactosaminyl-(1,3)-(alpha-L-fucosyl-(1,2))-D-galactose.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
	GO:0016758	transferase activity, transferring hexosyl groups	Catalysis of the transfer of a hexosyl group from one compound (donor) to another (acceptor).
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0006486	protein glycosylation	A protein modification process that results in the addition of a carbohydrate or carbohydrate derivative unit to a protein amino acid, e.g. the addition of glycan chains to proteins.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0032580	Golgi cisterna membrane	The lipid bilayer surrounding any of the thin, flattened compartments that form the central portion of the Golgi complex.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain A (Q70V26_HUMAN | Q70V26)

molecular function
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016758	transferase activity, transferring hexosyl groups	Catalysis of the transfer of a hexosyl group from one compound (donor) to another (acceptor).
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BHG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FUC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		U	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Val A:175 - Gly A:176	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3i0f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BGAT_HUMAN \| P16442
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	Q70V26_HUMAN \| Q70V26
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BGAT_HUMAN \| P16442
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q70V26_HUMAN \| Q70V26
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1lz7	GTB
3i0c	GTB C80S/C196S UNLIGANDED
3i0d	GTB C80S/C196S + UDP
3i0e	GTB C80S/C196S + H ANTIGEN
3i0g	GTB C80S/C196S + DA + UDP-GAL
3i0h	GTB C80S/C196S/C209S UNLIGANDED
3i0i	GTB C80S/C196S/C209S + UDP
3i0j	GTB C80S/C196S/C209S + H ANTIGEN
3i0k	GTB C80S/C196S/C209S + UDP + H ANTIGEN
3i0l	GTB C80S/C196S/C209S + DA + UDP-GAL

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (21, 21)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File