Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN TRYPTOPHAN HYDROXYLASE TYPE 1 WITH BOUND LP-521834 AND FE
 
Authors :  L. W. Tari, R. V. Swanson, M. J. Hunter
Date :  11 May 09  (Deposition) - 24 Nov 09  (Release) - 21 Apr 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Tryptophan 5-Hydroxylase 1, Alternative Splicing, Iron, Metal-Binding, Monooxygenase, Oxidoreductase, Phosphoprotein, Serotonin Biosynthesis (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Cianchetta, T. Stouch, W. Yu, Z. -C. Shi, L. W. Tari, R. V. Swanson, M. J. Hunter, I. D. Hoffman, Q. Liu
Mechanism Of Inhibition Of Novel Tryptophan Hydroxylase Inhibitors Revealed By Co-Crystal Structures And Kinetic Analysis
Curr Chem Genomics V. 4 19 2010
PubMed-ID: 19631532  |  Reference-DOI: 10.2174/1875397301004010019

(-) Compounds

Molecule 1 - TRYPTOPHAN 5-HYDROXYLASE 1
    ChainsA
    EC Number1.14.16.4
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymTRYPTOPHAN 5-MONOOXYGENASE 1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1FE1Ligand/IonFE (III) ION
2LX01Ligand/Ion4-(4-AMINO-6-{[(1R)-1-NAPHTHALEN-2-YLETHYL]AMINO}-1,3,5-TRIAZIN-2-YL)-L-PHENYLALANINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:272 , HIS A:277 , GLU A:317 , HOH A:421 , HOH A:516 , HOH A:517BINDING SITE FOR RESIDUE FE A 400
2AC2SOFTWAREGLY A:234 , TYR A:235 , ARG A:257 , TYR A:264 , THR A:265 , PRO A:266 , GLU A:267 , PRO A:268 , HIS A:272 , PHE A:313 , GLU A:317 , SER A:336 , SER A:337 , HOH A:418 , HOH A:432 , HOH A:438 , HOH A:449 , HOH A:506BINDING SITE FOR RESIDUE LX0 A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HF6)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ser A:346 -Gly A:347

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HF6)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BH4_AAA_HYDROXYL_1PS00367 Biopterin-dependent aromatic amino acid hydroxylases signature.TPH1_HUMAN268-279  1A:268-279

(-) Exons   (8, 8)

Asymmetric/Biological Unit (8, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2aENST000002500182aENSE00002158804chr11:18062872-18062193680TPH1_HUMAN1-39390--
1.3ENST000002500183ENSE00000886552chr11:18057689-18057506184TPH1_HUMAN40-101620--
1.4ENST000002500184ENSE00000886551chr11:18054921-18054821101TPH1_HUMAN101-134341A:104-134 (gaps)31
1.5bENST000002500185bENSE00000886550chr11:18051126-1805105968TPH1_HUMAN135-157231A:135-15723
1.6ENST000002500186ENSE00000886549chr11:18050908-18050712197TPH1_HUMAN157-223671A:157-22367
1.7ENST000002500187ENSE00001803012chr11:18048172-18048037136TPH1_HUMAN223-268461A:223-26846
1.8ENST000002500188ENSE00001617695chr11:18047248-18047122127TPH1_HUMAN268-310431A:268-31043
1.9ENST000002500189ENSE00001763303chr11:18045530-1804543596TPH1_HUMAN311-342321A:311-34232
1.10bENST0000025001810bENSE00001761007chr11:18044478-18044345134TPH1_HUMAN343-387451A:343-38745
1.11dENST0000025001811dENSE00002161624chr11:18042712-180391113602TPH1_HUMAN387-444581A:387-3937

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:280
 aligned with TPH1_HUMAN | P17752 from UniProtKB/Swiss-Prot  Length:444

    Alignment length:290
                                   113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393
           TPH1_HUMAN   104 TVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTI 393
               SCOP domains d3hf6a_ A: Tryp          tophan hydroxylase                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 3hf6A00 A:104-3          93 Phenylalanine Hydroxylase                                                                                                                                                                                                                                              CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhh----------.........hhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh..eeee.....hhhhhhhhhh..eeee................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.....eeee..eeee.hhhhhhhhhhhhhhh....eeee.hhhhhh...........eeeee.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------BH4_AAA_HYDR------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.4  PDB: A:104-134 (gaps)Exon 1.5b              -----------------------------------------------------------------Exon 1.7  PDB: A:223-268 UniProt: 223-268     ------------------------------------------Exon 1.9  PDB: A:311-342        Exon 1.10b  PDB: A:343-387 UniProt: 343-387  ------ Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------Exon 1.6  PDB: A:157-223 UniProt: 157-223                          --------------------------------------------Exon 1.8  PDB: A:268-310 UniProt: 268-310  ----------------------------------------------------------------------------1.11d   Transcript 1 (2)
                 3hf6 A 104 SVPWFPKKISDLDHC----------LDADHPGFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFRELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTI 393
                                   113    |    -     | 133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393
                                        118        129                                                                                                                                                                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HF6)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (TPH1_HUMAN | P17752)
molecular function
    GO:0016597    amino acid binding    Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016714    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from reduced pteridine and one other donor, and one atom of oxygen is incorporated into one donor.
    GO:0004510    tryptophan 5-monooxygenase activity    Catalysis of the reaction: L-tryptophan + tetrahydrobiopterin + O2 = 5-hydroxy-L-tryptophan + 4-alpha-hydroxytetrahydrobiopterin + H2O.
biological process
    GO:0009072    aromatic amino acid family metabolic process    The chemical reactions and pathways involving aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0046849    bone remodeling    The continuous turnover of bone matrix and mineral that involves first, an increase in resorption (osteoclastic activity) and later, reactive bone formation (osteoblastic activity). The process of bone remodeling takes place in the adult skeleton at discrete foci. The process ensures the mechanical integrity of the skeleton throughout life and plays an important role in calcium homeostasis. An imbalance in the regulation of bone resorption and bone formation results in many of the metabolic bone diseases, such as osteoporosis.
    GO:0007623    circadian rhythm    Any biological process in an organism that recurs with a regularity of approximately 24 hours.
    GO:0046219    indolalkylamine biosynthetic process    The chemical reactions and pathways resulting in the formation of indolalkylamines, indole or indole derivatives containing a primary, secondary, or tertiary amine group.
    GO:0060749    mammary gland alveolus development    The progression of the mammary gland alveolus over time, from its formation to its mature state. The mammary gland alveolus is a sac-like structure that is found in the mature gland.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0030279    negative regulation of ossification    Any process that stops, prevents, or reduces the frequency, rate or extent of bone formation.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0045600    positive regulation of fat cell differentiation    Any process that activates or increases the frequency, rate or extent of adipocyte differentiation.
    GO:0035902    response to immobilization stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of being rendered immobile.
    GO:0042427    serotonin biosynthetic process    The chemical reactions and pathways resulting in the formation of serotonin (5-hydroxytryptamine), a monoamine neurotransmitter occurring in the peripheral and central nervous systems, also having hormonal properties.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    LX0  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:346 - Gly A:347   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hf6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TPH1_HUMAN | P17752
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.16.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TPH1_HUMAN | P17752
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TPH1_HUMAN | P177521in9 1mlw 3hf8 3hfb 5j6d 5l01 5tpg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3HF6)