Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  OPTIMIZATION OF SPIROCYCLIC PROLINE TRYPTOPHANHYDROXYLASE-1 INHIBITORS
 
Authors :  A. J. Stein, D. R. Goldberg, S. De Lombaert, M. C. Holt
Date :  20 Oct 16  (Deposition) - 25 Jan 17  (Release) - 25 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Tph1, Iron, Acyl, Quanidine, Oxidoreductase-Inhibitor Complex, Oxidoreductase-Oxidoreductase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. R. Goldberg, S. De Lombaert, R. Aiello, P. Bourassa, N. Barucci, Q. Zhang, V. Paralkar, A. J. Stein, M. Holt, J. Valentine, W. Zavadoski
Optimization Of Spirocyclic Proline Tryptophan Hydroxylase- Inhibitors.
Bioorg. Med. Chem. Lett. V. 27 413 2017
PubMed-ID: 28041831  |  Reference-DOI: 10.1016/J.BMCL.2016.12.053

(-) Compounds

Molecule 1 - TRYPTOPHAN 5-HYDROXYLASE 1
    ChainsA
    EC Number1.14.16.4
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 104-402
    GeneTPH1, TPH, TPRH, TRPH
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymTRYPTOPHAN 5-MONOOXYGENASE 1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 5)

Asymmetric/Biological Unit (4, 5)
No.NameCountTypeFull Name
17H51Ligand/Ion(3S)-8-(2-AMINO-6-{(1R)-1-[5-CHLORO-3'-(METHYLSULFONYL)[1,1'-BIPHENYL]-2-YL]-2,2,2-TRIFLUOROETHOXY}PYRIMIDIN-4-YL)-2,8-DIAZASPIRO[4.5]DECANE-3-CARBOXYLIC ACID
2CCN2Ligand/IonACETONITRILE
3FE1Ligand/IonFE (III) ION
4TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:272 , HIS A:277 , GLU A:317 , TRS A:502binding site for residue FE A 501
2AC2SOFTWARETYR A:235 , PHE A:241 , PHE A:250 , PRO A:268 , HIS A:272 , GLU A:273 , HIS A:277 , TYR A:312 , GLU A:317 , FE A:501 , 7H5 A:505 , HOH A:645binding site for residue TRS A 502
3AC3SOFTWAREILE A:171 , ASN A:210 , ILE A:211 , GLN A:213 , HOH A:715binding site for residue CCN A 503
4AC4SOFTWAREGLU A:292 , MET A:386 , ARG A:387 , THR A:390 , HOH A:655 , HOH A:699 , HOH A:765binding site for residue CCN A 504
5AC5SOFTWARETYR A:235 , LEU A:236 , PRO A:238 , PHE A:241 , LEU A:242 , ARG A:257 , TYR A:264 , THR A:265 , PRO A:266 , GLU A:267 , PRO A:268 , HIS A:272 , ALA A:309 , TYR A:312 , GLU A:317 , SER A:336 , SER A:337 , CYS A:364 , ILE A:366 , TRS A:502 , HOH A:637 , HOH A:724binding site for residue 7H5 A 505

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5TPG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5TPG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5TPG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5TPG)

(-) Exons   (0, 0)

(no "Exon" information available for 5TPG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:271
                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhh.hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh.eeee.....hhhhhhhhhhh.eeee................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.....eeee..eeee.hhhhhhhhhhhhhhh....eeee.hhhhhh...........eeeee.hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tpg A 104 TVPWFPKKISDLDHCNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIK 394
                                   113    || 143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393 
                                        118|                                                                                                                                                                                                                                                               
                                         139                                                                                                                                                                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5TPG)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5TPG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5TPG)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    7H5  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CCN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5tpg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5tpg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TPH1_HUMAN | P17752
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.14.16.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TPH1_HUMAN | P17752
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TPH1_HUMAN | P177521in9 1mlw 3hf6 3hf8 3hfb 5j6d 5l01

(-) Related Entries Specified in the PDB File

5l01