2W0P - JenaLib

Asymmetric/Biological Unit (3, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000369850	1b	ENSE00001910769	X:153602994-153602874	121	FLNA_HUMAN	-	0	0	-	-
1.2a	ENST00000369850	2a	ENSE00001451045	X:153599729-153599241	489	FLNA_HUMAN	1-125	125	0	-	-
1.3	ENST00000369850	3	ENSE00001761667	X:153596458-153596210	249	FLNA_HUMAN	125-208	84	0	-	-
1.4	ENST00000369850	4	ENSE00001600780	X:153596106-153596009	98	FLNA_HUMAN	208-240	33	0	-	-
1.5	ENST00000369850	5	ENSE00001593508	X:153595912-153595765	148	FLNA_HUMAN	241-290	50	0	-	-
1.6	ENST00000369850	6	ENSE00001766993	X:153595218-153595100	119	FLNA_HUMAN	290-329	40	0	-	-
1.7	ENST00000369850	7	ENSE00001785883	X:153595007-153594930	78	FLNA_HUMAN	330-355	26	0	-	-
1.8	ENST00000369850	8	ENSE00001609326	X:153594838-153594676	163	FLNA_HUMAN	356-410	55	0	-	-
1.9	ENST00000369850	9	ENSE00001666330	X:153594592-153594392	201	FLNA_HUMAN	410-477	68	0	-	-
1.10	ENST00000369850	10	ENSE00001801647	X:153593854-153593717	138	FLNA_HUMAN	477-523	47	0	-	-
1.11a	ENST00000369850	11a	ENSE00001611867	X:153593627-153593504	124	FLNA_HUMAN	523-564	42	0	-	-
1.12a	ENST00000369850	12a	ENSE00001667367	X:153593325-153593189	137	FLNA_HUMAN	564-610	47	0	-	-
1.12c	ENST00000369850	12c	ENSE00001629480	X:153593087-153592894	194	FLNA_HUMAN	610-674	65	0	-	-
1.13	ENST00000369850	13	ENSE00001779880	X:153592740-153592627	114	FLNA_HUMAN	675-712	38	0	-	-
1.14	ENST00000369850	14	ENSE00001608264	X:153592533-153592390	144	FLNA_HUMAN	713-760	48	0	-	-
1.15	ENST00000369850	15	ENSE00001763171	X:153591152-153591029	124	FLNA_HUMAN	761-802	42	0	-	-
1.16	ENST00000369850	16	ENSE00001721592	X:153590946-153590786	161	FLNA_HUMAN	802-855	54	0	-	-
1.17	ENST00000369850	17	ENSE00001711674	X:153590700-153590610	91	FLNA_HUMAN	856-886	31	0	-	-
1.18	ENST00000369850	18	ENSE00001671781	X:153590516-153590347	170	FLNA_HUMAN	886-942	57	0	-	-
1.19	ENST00000369850	19	ENSE00001747813	X:153590155-153590038	118	FLNA_HUMAN	943-982	40	0	-	-
1.20	ENST00000369850	20	ENSE00001730581	X:153589938-153589676	263	FLNA_HUMAN	982-1069	88	0	-	-
1.21a	ENST00000369850	21a	ENSE00001650468	X:153588955-153588358	598	FLNA_HUMAN	1070-1269	200	0	-	-
1.22	ENST00000369850	22	ENSE00001799214	X:153588273-153588100	174	FLNA_HUMAN	1269-1327	59	0	-	-
1.23a	ENST00000369850	23a	ENSE00001747211	X:153588014-153587852	163	FLNA_HUMAN	1327-1381	55	0	-	-
1.24	ENST00000369850	24	ENSE00001776303	X:153587774-153587614	161	FLNA_HUMAN	1381-1435	55	0	-	-
1.25	ENST00000369850	25	ENSE00001730699	X:153587522-153587352	171	FLNA_HUMAN	1435-1492	58	0	-	-
1.26b	ENST00000369850	26b	ENSE00001594409	X:153586936-153586813	124	FLNA_HUMAN	1492-1533	42	0	-	-
1.27	ENST00000369850	27	ENSE00001770199	X:153586723-153586567	157	FLNA_HUMAN	1533-1585	53	0	-	-
1.28b	ENST00000369850	28b	ENSE00001690672	X:153585991-153585802	190	FLNA_HUMAN	1586-1649	64	0	-	-
1.29	ENST00000369850	29	ENSE00001616004	X:153585642-153585619	24	FLNA_HUMAN	1649-1657	9	0	-	-
1.30a	ENST00000369850	30a	ENSE00001716324	X:153583440-153583193	248	FLNA_HUMAN	1657-1739	83	0	-	-
1.31a	ENST00000369850	31a	ENSE00001764396	X:153583079-153582984	96	FLNA_HUMAN	1740-1771	32	0	-	-
1.32	ENST00000369850	32	ENSE00001736547	X:153582851-153582749	103	FLNA_HUMAN	1772-1806	35	0	-	-
1.33a	ENST00000369850	33a	ENSE00001766949	X:153582659-153582519	141	FLNA_HUMAN	1806-1853	48	0	-	-
1.33c	ENST00000369850	33c	ENSE00001653383	X:153582411-153582283	129	FLNA_HUMAN	1853-1896	44	0	-	-
1.34a	ENST00000369850	34a	ENSE00001618870	X:153582095-153581922	174	FLNA_HUMAN	1896-1954	59	0	-	-
1.35b	ENST00000369850	35b	ENSE00002195079	X:153581825-153581664	162	FLNA_HUMAN	1954-2008	55	0	-	-
1.36b	ENST00000369850	36b	ENSE00001723855	X:153581572-153581369	204	FLNA_HUMAN	2008-2076	69	0	-	-
1.36e	ENST00000369850	36e	ENSE00001619614	X:153581292-153581140	153	FLNA_HUMAN	2076-2127	52	0	-	-
1.36h	ENST00000369850	36h	ENSE00001651775	X:153581043-153580921	123	FLNA_HUMAN	2127-2168	42	0	-	-
1.37	ENST00000369850	37	ENSE00001674826	X:153580815-153580549	267	FLNA_HUMAN	2168-2257	90	2	A:2236-2257 B:2236-2257	22 22
1.38a	ENST00000369850	38a	ENSE00001618637	X:153580389-153580252	138	FLNA_HUMAN	2257-2303	47	2	A:2257-2303 B:2257-2303	47 47
1.39a	ENST00000369850	39a	ENSE00002154533	X:153580064-153579949	116	FLNA_HUMAN	2303-2341	39	2	A:2303-2328 B:2303-2329	26 27
1.39d	ENST00000369850	39d	ENSE00001796872	X:153579409-153579277	133	FLNA_HUMAN	2342-2386	45	0	-	-
1.39f	ENST00000369850	39f	ENSE00001667055	X:153578575-153578399	177	FLNA_HUMAN	2386-2445	60	0	-	-
1.39g	ENST00000369850	39g	ENSE00001781401	X:153578235-153578017	219	FLNA_HUMAN	2445-2518	74	0	-	-
1.40	ENST00000369850	40	ENSE00001665083	X:153577933-153577730	204	FLNA_HUMAN	2518-2586	69	0	-	-
1.41d	ENST00000369850	41d	ENSE00001866943	X:153577404-153577016	389	FLNA_HUMAN	2586-2647	62	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:93
 aligned with FLNA_HUMAN | P21333 from UniProtKB/Swiss-Prot  Length:2647

    Alignment length:93
                                  2245      2255      2265      2275      2285      2295      2305      2315      2325   
          FLNA_HUMAN   2236 GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP 2328
               SCOP domains d2w0pa_ A: Filamin a                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhheeehhhhh.ee....eeeeeehhhhh...eeeeeee....eeeeee.....eeeeee....eeeeeeeee..ee.....eeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE FILAMIN_REPEAT  PDB: - UniProt: 2233-2325                                                 -FI PROSITE
           Transcript 1 (1) Exon 1.37 [INCOMPLETE]---------------------------------------------Exon 1.39a [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) ---------------------Exon 1.38a  PDB: A:2257-2303 UniProt: 2257-2303------------------------- Transcript 1 (2)
                2w0p A 2236 GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP 2328
                                  2245      2255      2265      2275      2285      2295      2305      2315      2325

Chain B from PDB  Type:PROTEIN  Length:94
 aligned with FLNA_HUMAN | P21333 from UniProtKB/Swiss-Prot  Length:2647

    Alignment length:94
                                  2245      2255      2265      2275      2285      2295      2305      2315      2325    
          FLNA_HUMAN   2236 GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS 2329
               SCOP domains d2w0pb_ B: Filamin a                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Filamin-2w0pB01 B:2236-2322                                                            ------- Pfam domains (1)
           Pfam domains (2) Filamin-2w0pB02 B:2236-2322                                                            ------- Pfam domains (2)
         Sec.struct. author .hhhhheeehhhhh.......eeeeee........eeeeeee....eeeeee.....eeeeee....eeeeeeeee.................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE FILAMIN_REPEAT  PDB: - UniProt: 2233-2325                                                 -FIL PROSITE
           Transcript 1 (1) Exon 1.37 [INCOMPLETE]---------------------------------------------Exon 1.39a  PDB: B:2303-232 Transcript 1 (1)
           Transcript 1 (2) ---------------------Exon 1.38a  PDB: B:2257-2303 UniProt: 2257-2303-------------------------- Transcript 1 (2)
                2w0p B 2236 GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS 2329
                                  2245      2255      2265      2275      2285      2295      2305      2315      2325

Chain C from PDB  Type:PROTEIN  Length:9
 aligned with FBLI1_HUMAN | Q8WUP2 from UniProtKB/Swiss-Prot  Length:373

    Alignment length:9
         FBLI1_HUMAN      8 RVASSVFIT   16
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author .eeeeeeee Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                2w0p C    8 RVASSVFIT   16

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (74, 81)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (FLNA_HUMAN | P21333)

molecular function
	GO:0034988	Fc-gamma receptor I complex binding	Interacting selectively and non-covalently with one or more specific sites on the Fc-gamma receptor I complex. The complex functions primarily as an activating receptor for IgG.
	GO:0001664	G-protein coupled receptor binding	Interacting selectively and non-covalently with a G-protein coupled receptor.
	GO:0051020	GTPase binding	Interacting selectively and non-covalently with a GTPase, any enzyme that catalyzes the hydrolysis of GTP.
	GO:0048365	Rac GTPase binding	Interacting selectively and non-covalently with Rac protein, any member of the Rac subfamily of the Ras superfamily of monomeric GTPases.
	GO:0017160	Ral GTPase binding	Interacting selectively and non-covalently with Ral protein, any member of the Ral subfamily of the Ras superfamily of monomeric GTPases.
	GO:0017048	Rho GTPase binding	Interacting selectively and non-covalently with Rho protein, any member of the Rho subfamily of the Ras superfamily of monomeric GTPases. Proteins in the Rho subfamily are involved in relaying signals from cell-surface receptors to the actin cytoskeleton.
	GO:0046332	SMAD binding	Interacting selectively and non-covalently with a SMAD signaling protein.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0051015	actin filament binding	Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
	GO:0019900	kinase binding	Interacting selectively and non-covalently with a kinase, any enzyme that catalyzes the transfer of a phosphate group.
	GO:0031852	mu-type opioid receptor binding	Interacting selectively and non-covalently with a mu-type opioid receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
	GO:0031267	small GTPase binding	Interacting selectively and non-covalently with a small monomeric GTPase.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
	GO:0051764	actin crosslink formation	The process in which two or more actin filaments are connected together by proteins that act as crosslinks between the filaments. The crosslinked filaments may be on the same or differing axes.
	GO:0031532	actin cytoskeleton reorganization	A process that is carried out at the cellular level which results in dynamic structural changes to the arrangement of constituent parts of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0007195	adenylate cyclase-inhibiting dopamine receptor signaling pathway	The series of molecular signals generated as a consequence of a dopamine receptor binding to its physiological ligand, where the pathway proceeds with inhibition of adenylyl cyclase and a subsequent decrease in the concentration of cyclic AMP (cAMP).
	GO:0034329	cell junction assembly	A cellular process that results in the aggregation, arrangement and bonding together of a set of components to form a cell junction.
	GO:0030030	cell projection organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0051220	cytoplasmic sequestering of protein	The selective interaction of a protein with specific molecules in the cytoplasm, thereby inhibiting its transport into other areas of the cell.
	GO:0045184	establishment of protein localization	The directed movement of a protein to a specific location.
	GO:0042789	mRNA transcription from RNA polymerase II promoter	The cellular synthesis of messenger RNA (mRNA) from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter.
	GO:0090307	mitotic spindle assembly	The aggregation, arrangement and bonding together of a set of components to form the spindle that contributes to the process of mitosis.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0042177	negative regulation of protein catabolic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
	GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0016479	negative regulation of transcription from RNA polymerase I promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase I promoter.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0070527	platelet aggregation	The adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0002576	platelet degranulation	The regulated exocytosis of secretory granules containing preformed mediators such as histamine and serotonin by a platelet.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:2001046	positive regulation of integrin-mediated signaling pathway	Any process that activates or increases the frequency, rate or extent of integrin-mediated signaling pathway.
	GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
	GO:0042993	positive regulation of transcription factor import into nucleus	Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
	GO:0034394	protein localization to cell surface	A process in which a protein is transported to, or maintained in, a location within the external part of the cell wall and/or plasma membrane.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
	GO:0043113	receptor clustering	The receptor metabolic process that results in grouping of a set of receptors at a cellular location, often to amplify the sensitivity of a signaling response.
	GO:0030334	regulation of cell migration	Any process that modulates the frequency, rate or extent of cell migration.
	GO:0071526	semaphorin-plexin signaling pathway	A series of molecular signals generated as a consequence of a semaphorin receptor (composed of a plexin and a neurophilin) binding to a semaphorin ligand.
	GO:0044319	wound healing, spreading of cells	The migration of a cell along or through a wound gap that contributes to the reestablishment of a continuous surface.
cellular component
	GO:0031523	Myb complex	A multisubunit complex consisting of Myb and other proteins that regulates site specific DNA replication, gene amplification and transcriptional repression.
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0097440	apical dendrite	A dendrite that emerges near the apical pole of a neuron. In bipolar neurons, apical dendrites are located on the opposite side of the soma from the axon.
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0005911	cell-cell junction	A cell junction that forms a connection between two or more cells in a multicellular organism; excludes direct cytoplasmic junctions such as ring canals.
	GO:0030863	cortical cytoskeleton	The portion of the cytoskeleton that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0043198	dendritic shaft	Cylindric portion of the dendrite, directly stemming from the perikaryon, and carrying the dendritic spines.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0031941	filamentous actin	A two-stranded helical polymer of the protein actin.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain C (FBLI1_HUMAN | Q8WUP2)

molecular function
	GO:0031005	filamin binding	Interacting selectively and non-covalently with a filamin, any member of a family of high molecular mass cytoskeletal proteins that crosslink actin filaments to form networks and stress fibers. Filamins contain an amino-terminal alpha-actinin-like actin binding domain, which is followed by a rod-domain composed of 4 to 24 100-residue repetitive segments including a carboxy-terminal dimerization domain.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0034329	cell junction assembly	A cellular process that results in the aggregation, arrangement and bonding together of a set of components to form a cell junction.
	GO:0008360	regulation of cell shape	Any process that modulates the surface configuration of a cell.
	GO:0033623	regulation of integrin activation	Any process that modulates the frequency, rate, or extent of integrin activation.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
cellular component
	GO:0005938	cell cortex	The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0001725	stress fiber	A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (3, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (74, 81)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File