2FMM - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF EMSY-HP1 COMPLEX

Authors :   Y. Huang

Date :   09 Jan 06 (Deposition) - 23 May 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A,B,C,D,E
Biol. Unit 1: A,B,C,D,E  (2x)

Keywords :   Ent Domain, Chromo Shadow Domain, Emsy Protein, Heterochromatin Protein 1, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Huang, M. P. Myers, R. M. Xu
Crystal Structure Of The Hp1-Emsy Complex Reveals An Unusua Mode Of Hp1 Binding.
Structure V. 14 703 2006
PubMed-ID: 16615912 | Reference-DOI: 10.1016/J.STR.2006.01.007

Molecule 1 - PROTEIN EMSY
	Chains	:	E
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX-KG
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	N-TERMINAL DOMAIN
	Gene	:	EMSY, C11ORF30
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - CHROMOBOX PROTEIN HOMOLOG 1
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	CHROMO SHADOW DOMAIN
	Gene	:	CBX1, CBX
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HETEROCHROMATIN PROTEIN 1 HOMOLOG BETA, HP1 BETA, MODIFIER 1 PROTEIN, M31, HETEROCHROMATIN PROTEIN P25, HP1HSBETA, P25BETA

		1	2	3	4	5
Asymmetric Unit	:	A	B	C	D	E
Biological Unit 1 (2x)	:	A	B	C	D	E

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 8)

No.	Name	Count	Type	Full Name
1	SO4	8	Ligand/Ion	SULFATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:155 , CYS A:156 , PRO A:157 , GLN A:158 , VAL A:159 , HOH A:621 , HOH A:626 , HOH A:665 , HOH A:666 , HOH A:669	BINDING SITE FOR RESIDUE SO4 A 601
2	AC2	SOFTWARE	HOH C:674 , LYS D:155 , CYS D:156 , PRO D:157 , GLN D:158 , VAL D:159 , HOH D:633 , HOH D:634 , HOH D:635 , HOH D:652	BINDING SITE FOR RESIDUE SO4 D 602
3	AC3	SOFTWARE	LYS C:155 , CYS C:156 , PRO C:157 , GLN C:158 , VAL C:159 , HOH C:678	BINDING SITE FOR RESIDUE SO4 C 603
4	AC4	SOFTWARE	LYS B:155 , CYS B:156 , PRO B:157 , GLN B:158 , VAL B:159 , HOH B:635	BINDING SITE FOR RESIDUE SO4 B 604

(no "SS Bond" information available for 2FMM)

(no "Cis Peptide Bond" information available for 2FMM)

(no "SAP(SNP)/Variant" information available for 2FMM)

Asymmetric Unit (2, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ENT	PS51138	EMSY N-terminal (ENT) domain profile.	EMSY_HUMAN	16-100	1	E:16-100
2	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	CBX1_HUMAN	21-79 117-175	4	- A:117-175 B:117-175 C:117-175 D:117-175

Biological Unit 1 (2, 10)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ENT	PS51138	EMSY N-terminal (ENT) domain profile.	EMSY_HUMAN	16-100	2	E:16-100
2	CHROMO_2	PS50013	Chromo and chromo shadow domain profile.	CBX1_HUMAN	21-79 117-175	8	- A:117-175 B:117-175 C:117-175 D:117-175

Asymmetric Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000334736	1c	ENSE00001386178	chr11:76156069-76156172	104	EMSY_HUMAN	-	0	0	-	-
1.2a	ENST00000334736	2a	ENSE00002183521	chr11:76157944-76158052	109	EMSY_HUMAN	1-24	24	1	E:7-24	18
1.3	ENST00000334736	3	ENSE00001223548	chr11:76162902-76163001	100	EMSY_HUMAN	24-57	34	1	E:24-57	34
1.4a	ENST00000334736	4a	ENSE00002152029	chr11:76164358-76164432	75	EMSY_HUMAN	57-82	26	1	E:57-82	26
1.6b	ENST00000334736	6b	ENSE00001696572	chr11:76169227-76169402	176	EMSY_HUMAN	82-141	60	1	E:82-124	43
1.6e	ENST00000334736	6e	ENSE00001102458	chr11:76170980-76171129	150	EMSY_HUMAN	141-191	51	0	-	-
1.7	ENST00000334736	7	ENSE00001697568	chr11:76174865-76175124	260	EMSY_HUMAN	191-277	87	0	-	-
1.8	ENST00000334736	8	ENSE00001718146	chr11:76183608-76183884	277	EMSY_HUMAN	278-370	93	0	-	-
1.9a	ENST00000334736	9a	ENSE00001152940	chr11:76207259-76207513	255	EMSY_HUMAN	370-455	86	0	-	-
1.10a	ENST00000334736	10a	ENSE00001102425	chr11:76224430-76224579	150	EMSY_HUMAN	455-505	51	0	-	-
1.11b	ENST00000334736	11b	ENSE00001102392	chr11:76227186-76227356	171	EMSY_HUMAN	505-562	58	0	-	-
1.12	ENST00000334736	12	ENSE00001102435	chr11:76234199-76234335	137	EMSY_HUMAN	562-607	46	0	-	-
1.13a	ENST00000334736	13a	ENSE00001102384	chr11:76237506-76237679	174	EMSY_HUMAN	608-665	58	0	-	-
1.14	ENST00000334736	14	ENSE00001102400	chr11:76239312-76239510	199	EMSY_HUMAN	666-732	67	0	-	-
1.15	ENST00000334736	15	ENSE00001152902	chr11:76246939-76247103	165	EMSY_HUMAN	732-787	56	0	-	-
1.16	ENST00000334736	16	ENSE00001102418	chr11:76248839-76248994	156	EMSY_HUMAN	787-839	53	0	-	-
1.17	ENST00000334736	17	ENSE00001152894	chr11:76250643-76250684	42	EMSY_HUMAN	839-853	15	0	-	-
1.18c	ENST00000334736	18c	ENSE00001152887	chr11:76253260-76253411	152	EMSY_HUMAN	853-903	51	0	-	-
1.19c	ENST00000334736	19c	ENSE00001040003	chr11:76255303-76255866	564	EMSY_HUMAN	904-1091	188	0	-	-
1.20a	ENST00000334736	20a	ENSE00001040001	chr11:76256841-76257341	501	EMSY_HUMAN	1092-1258	167	0	-	-
1.22f	ENST00000334736	22f	ENSE00001403769	chr11:76260996-76262586	1591	EMSY_HUMAN	1259-1322	64	0	-	-

2.2	ENST00000393408	2	ENSE00001515177	chr17:46178560-46178117	444	CBX1_HUMAN	-	0	0	-	-
2.5	ENST00000393408	5	ENSE00002178956	chr17:46154403-46154227	177	CBX1_HUMAN	1-47	47	0	-	-
2.6a	ENST00000393408	6a	ENSE00000735652	chr17:46153540-46153363	178	CBX1_HUMAN	47-106	60	0	-	-
2.7b	ENST00000393408	7b	ENSE00000735651	chr17:46152462-46152368	95	CBX1_HUMAN	107-138	32	4	A:108-138 B:109-138 C:109-138 D:110-138	31 30 30 29
2.8c	ENST00000393408	8c	ENSE00001824299	chr17:46148941-46147414	1528	CBX1_HUMAN	138-185	48	4	A:138-175 B:138-175 C:138-175 D:138-175	38 38 38 38

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:68
 aligned with CBX1_HUMAN | P83916 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:68
                                   117       127       137       147       157       167        
           CBX1_HUMAN   108 EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
               SCOP domains d2fmma_ A: Heterochromatin protein 1, HP1                            SCOP domains
               CATH domains 2fmmA00 A:108-175  [code=2.40.50.40, no name defined]                CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh..eeeeeeeeee..eeeeeeee......eeeehhhhhhhhhhhhhhhhhh.eee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) ---------CHROMO_2  PDB: A:117-175 UniProt: 117-175                   PROSITE (1)
           Transcript 2 (1) Exon 2.7b  PDB: A:108-138      ------------------------------------- Transcript 2 (1)
           Transcript 2 (2) ------------------------------Exon 2.8c  PDB: A:138-175 [INCOMPLETE] Transcript 2 (2)
                 2fmm A 108 EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
                                   117       127       137       147       157       167

Chain B from PDB  Type:PROTEIN  Length:67
 aligned with CBX1_HUMAN | P83916 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:67
                                   118       128       138       148       158       168       
           CBX1_HUMAN   109 KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
               SCOP domains d2fmmb_ B: Heterochromatin protein 1, HP1                           SCOP domains
               CATH domains 2fmmB00 B:109-175  [code=2.40.50.40, no name defined]               CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..eeeeeeee......eeeeee.....eeeeehhhhhhhhhhhhhhhhhh.eee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) --------CHROMO_2  PDB: B:117-175 UniProt: 117-175                   PROSITE (1)
           Transcript 2 (1) Exon 2.7b  PDB: B:109-138     ------------------------------------- Transcript 2 (1)
           Transcript 2 (2) -----------------------------Exon 2.8c  PDB: B:138-175 [INCOMPLETE] Transcript 2 (2)
                 2fmm B 109 KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
                                   118       128       138       148       158       168

Chain C from PDB  Type:PROTEIN  Length:67
 aligned with CBX1_HUMAN | P83916 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:67
                                   118       128       138       148       158       168       
           CBX1_HUMAN   109 KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
               SCOP domains d2fmmc_ C: Heterochromatin protein 1, HP1                           SCOP domains
               CATH domains 2fmmC00 C:109-175  [code=2.40.50.40, no name defined]               CATH domains
               Pfam domains ------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..eeeeeeee......eeeeee......eeeehhhhhhhhhhhhhhhhhh.eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) --------CHROMO_2  PDB: C:117-175 UniProt: 117-175                   PROSITE (1)
           Transcript 2 (1) Exon 2.7b  PDB: C:109-138     ------------------------------------- Transcript 2 (1)
           Transcript 2 (2) -----------------------------Exon 2.8c  PDB: C:138-175 [INCOMPLETE] Transcript 2 (2)
                 2fmm C 109 KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
                                   118       128       138       148       158       168

Chain D from PDB  Type:PROTEIN  Length:66
 aligned with CBX1_HUMAN | P83916 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:66
                                   119       129       139       149       159       169      
           CBX1_HUMAN   110 PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
               SCOP domains d2fmmd_ D: Heterochromatin protein 1, HP1                          SCOP domains
               CATH domains 2fmmD00 D:110-175  [code=2.40.50.40, no name defined]              CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhh..eeeeeeee......eeeeee......eeeehhhhhhhhhhhhhhhhhhhhee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------ PROSITE (2)
                PROSITE (1) -------CHROMO_2  PDB: D:117-175 UniProt: 117-175                   PROSITE (1)
           Transcript 2 (1) Exon 2.7b  PDB: D:110-138    ------------------------------------- Transcript 2 (1)
           Transcript 2 (2) ----------------------------Exon 2.8c  PDB: D:138-175 [INCOMPLETE] Transcript 2 (2)
                 2fmm D 110 PRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPS 175
                                   119       129       139       149       159       169

Chain E from PDB  Type:PROTEIN  Length:118
 aligned with EMSY_HUMAN | Q7Z589 from UniProtKB/Swiss-Prot  Length:1322

    Alignment length:118
                                    16        26        36        46        56        66        76        86        96       106       116        
           EMSY_HUMAN     7 TLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAI 124
               SCOP domains --d2fmme1 E:9-124 Emsy                                                                                                 SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh.eeeeee...hhhh.eeeee......ee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------ENT  PDB: E:16-100 UniProt: 16-100                                                   ------------------------ PROSITE
           Transcript 1 (1) Exon 1.2a         --------------------------------Exon 1.4a  PDB: E:57-82   ------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.3  PDB: E:24-57            ------------------------Exon 1.6b  PDB: E:82-124 UniProt: 82-141    Transcript 1 (2)
                 2fmm E   7 GPLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVANAAI 124
                                    16        26        36        46        56        66        76        86        96       106       116

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: ENT-like (3)

Superfamily: ENT-like (3)

Family: Emsy N terminal (ENT) domain-like (3)

Protein domain: Emsy (2)

Human (Homo sapiens) [TaxId: 9606] (2)

d2fmme1

E:9-124

Class: All beta proteins (24004)

Fold: SH3-like barrel (1035)

Superfamily: Chromo domain-like (82)

Family: Chromo domain (41)

Protein domain: Heterochromatin protein 1, HP1 (11)

Human (Homo sapiens) [TaxId: 9606] (3)

2a	d2fmma_	A:
2b	d2fmmb_	B:
2c	d2fmmc_	C:
2d	d2fmmd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: OB fold (Dihydrolipoamide Acetyltransferase, E2P) (1040)

Homologous Superfamily: [code=2.40.50.40, no name defined] (161)

Human (Homo sapiens) (86)

1a	2fmmD00	D:110-175
1b	2fmmB00	B:109-175
1c	2fmmC00	C:109-175
1d	2fmmA00	A:108-175

(no "Pfam Domain" information available for 2FMM)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (CBX1_HUMAN | P83916)

molecular function
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:1990226	histone methyltransferase binding	Interacting selectively and non-covalently with a histone methyltransferase enzyme.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
cellular component
	GO:0000785	chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
	GO:0010369	chromocenter	A region in which centric, heterochromatic portions of one or more chromosomes form a compact structure.
	GO:0000775	chromosome, centromeric region	The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
	GO:0001939	female pronucleus	The pronucleus originating from the ovum that is being fertilized.
	GO:0001940	male pronucleus	The pronucleus originating from the spermatozoa that was involved in fertilization.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005720	nuclear heterochromatin	A condensed form of chromatin, occurring in the nucleus during interphase, that stains strongly with basophilic dyes. The DNA of heterochromatin is typically replicated at a later stage in the cell-division cycle than euchromatin.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005721	pericentric heterochromatin	Heterochromatin that is located adjacent to the CENP-A rich centromere 'central core' and characterized by the modified histone H3K9me3.
	GO:0005819	spindle	The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

Chain E (EMSY_HUMAN | Q7Z589)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fmm)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2fmm
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CBX1_HUMAN \| P83916
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	EMSY_HUMAN \| Q7Z589
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CBX1_HUMAN \| P83916
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	EMSY_HUMAN \| Q7Z589
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CBX1_HUMAN \| P83916	:	1guw 1s4z 3f2u 3q6s 5t1g
	EMSY_HUMAN \| Q7Z589	:	1utu 1uz3

(no "Related Entries Specified in the PDB File" available for 2FMM)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 5)

Exons (6, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 5)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (22, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File