Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  HP1 CHROMO SHADOW DOMAIN IN COMPLEX WITH PXVXL MOTIF OF CAF-1
 
Authors :  A. Thiru, D. Nietlispach, H. R. Mott, M. Okuwaki, D. Lyon, P. R. Nielsen, M. Hirshberg, A. Verreault, N. V. Murzina, E. D. Laue
Date :  19 Jan 04  (Deposition) - 23 Mar 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C  (25x)
Keywords :  Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Thiru, D. Nietlispach, H. R. Mott, M. Okuwaki, D. Lyon, P. R. Nielsen, M. Hirshberg, A. Verreault, N. V. Murzina, E. D. Laue
Structural Basis Of Hp1/Pxvxl Motif Peptide Interactions And Hp1 Localisation To Heterochromatin.
Embo J. V. 23 489 2004
PubMed-ID: 14765118  |  Reference-DOI: 10.1038/SJ.EMBOJ.7600088
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CHROMOBOX PROTEIN HOMOLOG 1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PET16B
    Fragment: CHROMO SHADOW DOMAIN
    Gene: CBX1, CBX
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: HETEROCHROMATIN PROTEIN 1 HOMOLOG BETA, HP1 BETA, MODIFIER 1 PROTEIN, M31, HETEROCHROMATIN PROTEIN P25
 
Molecule 2 - CHROMATIN ASSEMBLY FACTOR 1 SUBUNIT A
    Chains: C
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PGEX2T
    Fragment: CHROMATIN ASSEMBLY FACTOR 1
    Gene: CHAF1A, CAIP150
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: CAF-1 SUBUNIT A, CHROMATIN ASSEMBLY FACTOR I P150 SUBUNIT, CAF-I 150 KDA SUBUNIT, CAF-IP150

 Structural Features

(-) Chains, Units

  
NMR Structure (25x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1S4Z)

(-) Sites  (0, 0)

(no "Site" information available for 1S4Z)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1S4Z)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S4Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1S4Z)

(-) PROSITE Motifs  (1, 2)

NMR Structure (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CHROMO_2PS50013 Chromo and chromo shadow domain profile.CBX1_HUMAN21-79
117-175
 		  2-
A:117-175
B:117-175
CBX1_MOUSE21-79
117-175
 		  2-
A:117-175
B:117-175

(-) Exons   (0, 0)

(no "Exon" information available for 1S4Z)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:75
 aligned with CBX1_HUMAN | P83916 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:75
                                   111       121       131       141       151       161       171     
           CBX1_HUMAN   102 KKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSE 176
               SCOP domains d1s4za_ A: Heterochromatin protein 1, HP1                                   SCOP domains
               CATH domains 1s4zA00 A:102-176  [code=2.40.50.40, no name defined]                       CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............................eeee........eeeehhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------CHROMO_2  PDB: A:117-175 UniProt: 117-175                  - PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 1s4z A 102 HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSD 176
                                   111       121       131       141       151       161       171     


Chain A from PDB  Type:PROTEIN  Length:75
 aligned with CBX1_MOUSE | P83917 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:75
                                   111       121       131       141       151       161       171     
           CBX1_MOUSE   102 KKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSE 176
               SCOP domains d1s4za_ A: Heterochromatin protein 1, HP1                                   SCOP domains
               CATH domains 1s4zA00 A:102-176  [code=2.40.50.40, no name defined]                       CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............................eeee........eeeehhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------CHROMO_2  PDB: A:117-175 UniProt: 117-175                  - PROSITE (2)
                 Transcript --------------------------------------------------------------------------- Transcript
                 1s4z A 102 HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSD 176
                                   111       121       131       141       151       161       171     


Chain B from PDB  Type:PROTEIN  Length:75
 aligned with CBX1_HUMAN | P83916 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:75
                                   111       121       131       141       151       161       171     
           CBX1_HUMAN   102 KKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSE 176
               SCOP domains d1s4zb_ B: Heterochromatin protein 1, HP1                                   SCOP domains
               CATH domains 1s4zB00 B:102-176  [code=2.40.50.40, no name defined]                       CATH domains
           Pfam domains (1) -------------Chromo_shadow-1s4zB01 B:115-172                           ---- Pfam domains (1)
           Pfam domains (2) -------------Chromo_shadow-1s4zB02 B:115-172                           ---- Pfam domains (2)
         Sec.struct. author .................eeee...eee..eee..eee.........hhhhhhhhhhhhhhhhhhhheee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------CHROMO_2  PDB: B:117-175 UniProt: 117-175                  - PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 1s4z B 102 HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSD 176
                                   111       121       131       141       151       161       171     


Chain B from PDB  Type:PROTEIN  Length:75
 aligned with CBX1_MOUSE | P83917 from UniProtKB/Swiss-Prot  Length:185

    Alignment length:75
                                   111       121       131       141       151       161       171     
           CBX1_MOUSE   102 KKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSE 176
               SCOP domains d1s4zb_ B: Heterochromatin protein 1, HP1                                   SCOP domains
               CATH domains 1s4zB00 B:102-176  [code=2.40.50.40, no name defined]                       CATH domains
           Pfam domains (1) -------------Chromo_shadow-1s4zB01 B:115-172                           ---- Pfam domains (1)
           Pfam domains (2) -------------Chromo_shadow-1s4zB02 B:115-172                           ---- Pfam domains (2)
         Sec.struct. author .................eeee...eee..eee..eee.........hhhhhhhhhhhhhhhhhhhheee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------CHROMO_2  PDB: B:117-175 UniProt: 117-175                  - PROSITE (2)
                 Transcript --------------------------------------------------------------------------- Transcript
                 1s4z B 102 HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSD 176
                                   111       121       131       141       151       161       171     


Chain C from PDB  Type:PROTEIN  Length:30
 aligned with CAF1A_MOUSE | Q9QWF0 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:53
                                   195       205       215       225       235   
          CAF1A_MOUSE   186 GSLQSCPELTPGSRTCPTKELSSWSKAGDLLFIEKVPVVVLEDILATKPSIAS 238
               SCOP domains ----------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------- CATH domains
               Pfam domains ------------------------CAF-1_p150-1s4zC01 C:210-238  Pfam domains
         Sec.struct. author .-----------------------............eee.............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                 1s4z C 209 G-----------------------SKAGDLLFIEKVPVVVLEDILATKPSIAS 238
                            |        -         -    |  215       225       235   
                            |                     210                            
                          209
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 3)

NMR Structure
(-)
Clan: Tudor (88)
(-)
Clan: no clan defined [family: CAF-1_p150] (1)

(-) Gene Ontology  (32, 50)

NMR Structure(hide GO term definitions)
Chain A,B   (CBX1_MOUSE | P83917)
molecular function
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:1990226    histone methyltransferase binding    Interacting selectively and non-covalently with a histone methyltransferase enzyme.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
cellular component
    GO:0000785    chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
    GO:0010369    chromocenter    A region in which centric, heterochromatic portions of one or more chromosomes form a compact structure.
    GO:0000775    chromosome, centromeric region    The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
    GO:0000781    chromosome, telomeric region    The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0001939    female pronucleus    The pronucleus originating from the ovum that is being fertilized.
    GO:0001940    male pronucleus    The pronucleus originating from the spermatozoa that was involved in fertilization.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005721    pericentric heterochromatin    Heterochromatin that is located adjacent to the CENP-A rich centromere 'central core' and characterized by the modified histone H3K9me3.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

Chain A,B   (CBX1_HUMAN | P83916)
molecular function
    GO:0003682    chromatin binding    Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:1990226    histone methyltransferase binding    Interacting selectively and non-covalently with a histone methyltransferase enzyme.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0045892    negative regulation of transcription, DNA-templated    Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
cellular component
    GO:0000785    chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
    GO:0010369    chromocenter    A region in which centric, heterochromatic portions of one or more chromosomes form a compact structure.
    GO:0000775    chromosome, centromeric region    The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
    GO:0001939    female pronucleus    The pronucleus originating from the ovum that is being fertilized.
    GO:0001940    male pronucleus    The pronucleus originating from the spermatozoa that was involved in fertilization.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0005720    nuclear heterochromatin    A condensed form of chromatin, occurring in the nucleus during interphase, that stains strongly with basophilic dyes. The DNA of heterochromatin is typically replicated at a later stage in the cell-division cycle than euchromatin.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005721    pericentric heterochromatin    Heterochromatin that is located adjacent to the CENP-A rich centromere 'central core' and characterized by the modified histone H3K9me3.
    GO:0005819    spindle    The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

Chain C   (CAF1A_MOUSE | Q9QWF0)
molecular function
    GO:0070087    chromo shadow domain binding    Interacting selectively and non-covalently with a chromo shadow domain, a protein domain that is distantly related, and found in association with, the chromo domain.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006335    DNA replication-dependent nucleosome assembly    The formation of nucleosomes on newly replicated DNA, coupled to strand elongation.
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0031497    chromatin assembly    The assembly of DNA, histone proteins, other associated proteins, and sometimes RNA, into chromatin structure, beginning with the formation of the basic unit, the nucleosome, followed by organization of the nucleosomes into higher order structures, ultimately giving rise to a complex organization of specific domains within the nucleus.
    GO:0006334    nucleosome assembly    The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
cellular component
    GO:0033186    CAF-1 complex    A conserved heterotrimeric protein complex that promotes histone H3 and H4 deposition onto newly synthesized DNA during replication or DNA repair; specifically facilitates replication-dependent nucleosome assembly with the major histone H3 (H3.1). In many species the CAF-1 subunits are designated p150, p60, and p48.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0000790    nuclear chromatin    The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1s4z)
 
  Sites
(no "Sites" information available for 1s4z)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s4z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s4z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAF1A_MOUSE | Q9QWF0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CBX1_HUMAN | P83916
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  CBX1_MOUSE | P83917
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAF1A_MOUSE | Q9QWF0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CBX1_HUMAN | P83916
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CBX1_MOUSE | P83917
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CBX1_HUMAN | P83916: 1guw 2fmm 3f2u 3q6s 5t1g
        CBX1_MOUSE | P83917: 1ap0 1dz1 1guw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1S4Z)