|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2RO4) |
(no "Site" information available for 2RO4) |
(no "SS Bond" information available for 2RO4) |
(no "Cis Peptide Bond" information available for 2RO4) |
(no "SAP(SNP)/Variant" information available for 2RO4) |
NMR Structure (1, 2)
|
(no "Exon" information available for 2RO4) |
NMR StructureChain A from PDB Type:PROTEIN Length:53 aligned with ABRB_BACSU | P08874 from UniProtKB/Swiss-Prot Length:96 Alignment length:53 12 22 32 42 52 ABRB_BACSU 3 MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT 55 SCOP domains ----------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----SPOVT_ABRB PDB: A:5-50 UniProt: 7-52 --- PROSITE Transcript ----------------------------------------------------- Transcript 2ro4 A 1 MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT 53 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:53 aligned with ABRB_BACSU | P08874 from UniProtKB/Swiss-Prot Length:96 Alignment length:53 12 22 32 42 52 ABRB_BACSU 3 MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT 55 SCOP domains ----------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------- CATH domains Pfam domains (1) -------Antitoxin-MazE-2ro4B01 B:8-53 Pfam domains (1) Pfam domains (2) -------Antitoxin-MazE-2ro4B02 B:8-53 Pfam domains (2) SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs) PROSITE ----SPOVT_ABRB PDB: B:5-50 UniProt: 7-52 --- PROSITE Transcript ----------------------------------------------------- Transcript 2ro4 B 1 MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPNMT 53 10 20 30 40 50
|
(no "SCOP Domain" information available for 2RO4) |
(no "CATH Domain" information available for 2RO4) |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (ABRB_BACSU | P08874)
|
|
|
|
|
|
|