|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2RO5) |
(no "Site" information available for 2RO5) |
(no "SS Bond" information available for 2RO5) |
(no "Cis Peptide Bond" information available for 2RO5) |
(no "SAP(SNP)/Variant" information available for 2RO5) |
NMR Structure (1, 2)
|
(no "Exon" information available for 2RO5) |
NMR StructureChain A from PDB Type:PROTEIN Length:55 aligned with SP5T_BACSU | P37554 from UniProtKB/Swiss-Prot Length:178 Alignment length:55 10 20 30 40 50 SP5T_BACSU 1 MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISEL 55 SCOP domains ------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ----SPOVT_ABRB PDB: A:5-51 UniProt: 5-51 ---- PROSITE Transcript ------------------------------------------------------- Transcript 2ro5 A 1 MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISEL 55 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:55 aligned with SP5T_BACSU | P37554 from UniProtKB/Swiss-Prot Length:178 Alignment length:55 10 20 30 40 50 SP5T_BACSU 1 MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISEL 55 SCOP domains ------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------- CATH domains Pfam domains (1) -------Antitoxin-MazE-2ro5B01 B:8-54 - Pfam domains (1) Pfam domains (2) -------Antitoxin-MazE-2ro5B02 B:8-54 - Pfam domains (2) SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs) PROSITE ----SPOVT_ABRB PDB: B:5-51 UniProt: 5-51 ---- PROSITE Transcript ------------------------------------------------------- Transcript 2ro5 B 1 MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISEL 55 10 20 30 40 50
|
(no "SCOP Domain" information available for 2RO5) |
(no "CATH Domain" information available for 2RO5) |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (SP5T_BACSU | P37554)
|
|
|
|
|
|
|