|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2RO3) |
(no "Site" information available for 2RO3) |
(no "SS Bond" information available for 2RO3) |
(no "Cis Peptide Bond" information available for 2RO3) |
(no "SAP(SNP)/Variant" information available for 2RO3) |
NMR Structure (1, 2)
|
(no "Exon" information available for 2RO3) |
NMR StructureChain A from PDB Type:PROTEIN Length:54 aligned with ABH_BACSU | P39758 from UniProtKB/Swiss-Prot Length:92 Alignment length:54 10 20 30 40 50 ABH_BACSU 1 MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC 54 SCOP domains d2ro3a_ A: Putative transition state regulator ABH SCOP domains CATH domains ------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs) PROSITE ----SPOVT_ABRB PDB: A:5-50 UniProt: 5-50 ---- PROSITE Transcript ------------------------------------------------------ Transcript 2ro3 A 1 MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC 54 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:54 aligned with ABH_BACSU | P39758 from UniProtKB/Swiss-Prot Length:92 Alignment length:54 10 20 30 40 50 ABH_BACSU 1 MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC 54 SCOP domains d2ro3b_ B: Putative transition state regulator ABH SCOP domains CATH domains ------------------------------------------------------ CATH domains Pfam domains (1) -------Antitoxin-MazE-2ro3B01 B:8-52 -- Pfam domains (1) Pfam domains (2) -------Antitoxin-MazE-2ro3B02 B:8-52 -- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs) PROSITE ----SPOVT_ABRB PDB: B:5-50 UniProt: 5-50 ---- PROSITE Transcript ------------------------------------------------------ Transcript 2ro3 B 1 MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVC 54 10 20 30 40 50
|
NMR Structure
|
(no "CATH Domain" information available for 2RO3) |
NMR Structure
|
NMR Structure(hide GO term definitions) Chain A,B (ABH_BACSU | P39758)
|
|
|
|
|
|
|