|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1YFB) |
Sites (0, 0)| (no "Site" information available for 1YFB) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1YFB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1YFB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1YFB) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1YFB) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:52 aligned with ABRB_BACSU | P08874 from UniProtKB/Swiss-Prot Length:96 Alignment length:52 11 21 31 41 51 ABRB_BACSU 2 FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN 53 SCOP domains d1yfba_ A: SCOP domains CATH domains ---------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs) PROSITE -----SPOVT_ABRB PDB: A:7-52 UniProt: 7-52 - PROSITE Transcript ---------------------------------------------------- Transcript 1yfb A 2 FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN 53 11 21 31 41 51 Chain B from PDB Type:PROTEIN Length:52 aligned with ABRB_BACSU | P08874 from UniProtKB/Swiss-Prot Length:96 Alignment length:52 11 21 31 41 51 ABRB_BACSU 2 FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN 53 SCOP domains d1yfbb_ B: SCOP domains CATH domains ---------------------------------------------------- CATH domains Pfam domains (1) --------Antitoxin-MazE-1yfbB01 B:10-53 Pfam domains (1) Pfam domains (2) --------Antitoxin-MazE-1yfbB02 B:10-53 Pfam domains (2) SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs) PROSITE -----SPOVT_ABRB PDB: B:7-52 UniProt: 7-52 - PROSITE Transcript ---------------------------------------------------- Transcript 1yfb B 2 FMKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIILKKYKPN 53 11 21 31 41 51
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1YFB) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A,B (ABRB_BACSU | P08874)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|