2LSK - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   C-TERMINAL DOMAIN OF HUMAN REV1 IN COMPLEX WITH DNA-POLYMERASE H (ETA)

Authors :   A. Pozhidaeva, Y. Pustovalova, I. Bezsonova, D. Korzhnev

Date :   01 May 12 (Deposition) - 27 Jun 12 (Release) - 19 Jun 13 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)
NMR Structure *: A,B  (1x)

Keywords :   Dna Polymerase, Translesion Synthesis, Dna Repair, Protein Binding- Protein Binding Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Pozhidaeva, Y. Pustovalova, S. D'Souza, I. Bezsonova, G. C. Walker D. M. Korzhnev
Nmr Structure And Dynamics Of The C-Terminal Domain From Human Rev1 And Its Complex With Rev1 Interacting Region Of Dna Polymerase Eta.
Biochemistry V. 51 5506 2012
PubMed-ID: 22691049 | Reference-DOI: 10.1021/BI300566Z

Molecule 1 - DNA REPAIR PROTEIN REV1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	C-TERMINAL DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ALPHA INTEGRIN-BINDING PROTEIN 80, AIBP80, REV1-LIKE TERMINAL DEOXYCYTIDYL TRANSFERASE

Molecule 2 - DNA POLYMERASE ETA
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28B
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RAD30 HOMOLOG A, XERODERMA PIGMENTOSUM VARIANT TYPE PROTEIN

		1	2
NMR Structure (20x)	:	A	B
NMR Structure * (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2LSK)

(no "Site" information available for 2LSK)

(no "SS Bond" information available for 2LSK)

(no "Cis Peptide Bond" information available for 2LSK)

NMR Structure (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021234	K	535	E	POLH_HUMAN	Disease (XPV)	56307355	B	K	535	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021234	K	535	E	POLH_HUMAN	Disease (XPV)	56307355	B	K	535	E

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2LSK)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000258428	1a	ENSE00001515354	chr2:100106497-100106279	219	REV1_HUMAN	-	0	0	-	-
1.2	ENST00000258428	2	ENSE00000921861	chr2:100081447-100081384	64	REV1_HUMAN	1-18	18	0	-	-
1.3b	ENST00000258428	3b	ENSE00000921860	chr2:100079084-100078958	127	REV1_HUMAN	19-61	43	0	-	-
1.5	ENST00000258428	5	ENSE00001637671	chr2:100065966-100065798	169	REV1_HUMAN	61-117	57	0	-	-
1.6	ENST00000258428	6	ENSE00001757863	chr2:100058931-100058779	153	REV1_HUMAN	117-168	52	0	-	-
1.7a	ENST00000258428	7a	ENSE00001698319	chr2:100055772-100055063	710	REV1_HUMAN	168-405	238	0	-	-
1.9b	ENST00000258428	9b	ENSE00001623485	chr2:100052403-100052296	108	REV1_HUMAN	405-441	37	0	-	-
1.10	ENST00000258428	10	ENSE00001751683	chr2:100050910-100050794	117	REV1_HUMAN	441-480	40	0	-	-
1.12a	ENST00000258428	12a	ENSE00000921854	chr2:100046410-100046302	109	REV1_HUMAN	480-516	37	0	-	-
1.14b	ENST00000258428	14b	ENSE00001685794	chr2:100040742-100040614	129	REV1_HUMAN	516-559	44	0	-	-
1.15	ENST00000258428	15	ENSE00001749185	chr2:100038115-100037961	155	REV1_HUMAN	559-611	53	0	-	-
1.16b	ENST00000258428	16b	ENSE00001690779	chr2:100035409-100035290	120	REV1_HUMAN	611-651	41	0	-	-
1.17b	ENST00000258428	17b	ENSE00001626429	chr2:100029413-100029193	221	REV1_HUMAN	651-724	74	0	-	-
1.18a	ENST00000258428	18a	ENSE00001733763	chr2:100027329-100027157	173	REV1_HUMAN	725-782	58	0	-	-
1.19b	ENST00000258428	19b	ENSE00001627924	chr2:100024593-100024491	103	REV1_HUMAN	782-816	35	0	-	-
1.20b	ENST00000258428	20b	ENSE00001802837	chr2:100022952-100022787	166	REV1_HUMAN	817-872	56	0	-	-
1.20h	ENST00000258428	20h	ENSE00001790412	chr2:100022568-100022372	197	REV1_HUMAN	872-937	66	0	-	-
1.21	ENST00000258428	21	ENSE00001641934	chr2:100021140-100020907	234	REV1_HUMAN	938-1015	78	0	-	-
1.22	ENST00000258428	22	ENSE00001774065	chr2:100020278-100020158	121	REV1_HUMAN	1016-1056	41	0	-	-
1.23d	ENST00000258428	23d	ENSE00001793684	chr2:100019569-100019352	218	REV1_HUMAN	1056-1128	73	0	-	-
1.24a	ENST00000258428	24a	ENSE00000921842	chr2:100019263-100019107	157	REV1_HUMAN	1129-1181	53	1	A:1157-1181	25
1.24e	ENST00000258428	24e	ENSE00000921841	chr2:100018809-100018707	103	REV1_HUMAN	1181-1215	35	1	A:1181-1215	35
1.25b	ENST00000258428	25b	ENSE00000921840	chr2:100017815-100016938	878	REV1_HUMAN	1215-1251	37	1	A:1215-1251	37

2.1a	ENST00000372236	1a	ENSE00001717994	chr6:43543887-43544177	291	POLH_HUMAN	-	0	0	-	-
2.2	ENST00000372236	2	ENSE00001457304	chr6:43550053-43550193	141	POLH_HUMAN	1-46	46	0	-	-
2.3	ENST00000372236	3	ENSE00002161294	chr6:43550744-43550878	135	POLH_HUMAN	46-91	46	0	-	-
2.4b	ENST00000372236	4b	ENSE00000752927	chr6:43555009-43555226	218	POLH_HUMAN	91-164	74	0	-	-
2.5	ENST00000372236	5	ENSE00000481500	chr6:43565433-43565602	170	POLH_HUMAN	164-220	57	0	-	-
2.6	ENST00000372236	6	ENSE00001172213	chr6:43568725-43568828	104	POLH_HUMAN	221-255	35	0	-	-
2.7	ENST00000372236	7	ENSE00001172207	chr6:43571629-43571748	120	POLH_HUMAN	255-295	41	0	-	-
2.8	ENST00000372236	8	ENSE00001172201	chr6:43572352-43572475	124	POLH_HUMAN	295-336	42	0	-	-
2.9	ENST00000372236	9	ENSE00001172195	chr6:43572991-43573056	66	POLH_HUMAN	337-358	22	0	-	-
2.10	ENST00000372236	10	ENSE00001172191	chr6:43578291-43578460	170	POLH_HUMAN	359-415	57	0	-	-
2.11a	ENST00000372236	11a	ENSE00001861041	chr6:43581397-43583397	2001	POLH_HUMAN	415-713	299	1	B:524-539	16

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:95
 aligned with REV1_HUMAN | Q9UBZ9 from UniProtKB/Swiss-Prot  Length:1251

    Alignment length:95
                                  1166      1176      1186      1196      1206      1216      1226      1236      1246     
          REV1_HUMAN   1157 PNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT 1251
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.24a [INCOMPLETE]  ---------------------------------Exon 1.25b  PDB: A:1215-1251          Transcript 1 (1)
           Transcript 1 (2) ------------------------Exon 1.24e  PDB: A:1181-1215       ------------------------------------ Transcript 1 (2)
                2lsk A 1157 GNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT 1251
                                  1166      1176      1186      1196      1206      1216      1226      1236      1246

Chain B from PDB  Type:PROTEIN  Length:16
 aligned with POLH_HUMAN | Q9Y253 from UniProtKB/Swiss-Prot  Length:713

    Alignment length:16
                                   533      
          POLH_HUMAN    524 QSTGTEPFFKQKSLLL  539
               SCOP domains ---------------- SCOP domains
               CATH domains ---------------- CATH domains
               Pfam domains ---------------- Pfam domains
         Sec.struct. author .......hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -----------E---- SAPs(SNPs)
                    PROSITE ---------------- PROSITE
               Transcript 2 Exon 2.11a       Transcript 2
                2lsk B  524 QSTGTEPFFKQKSLLL  539
                                   533

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2LSK)

(no "CATH Domain" information available for 2LSK)

(no "Pfam Domain" information available for 2LSK)

NMR Structure(hide GO term definitions)

Chain A (REV1_HUMAN | Q9UBZ9)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003684	damaged DNA binding	Interacting selectively and non-covalently with damaged DNA.
	GO:0017125	deoxycytidyl transferase activity	Catalysis of the insertion of a dCMP residue opposite a template abasic site in DNA.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0071897	DNA biosynthetic process	The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0042276	error-prone translesion synthesis	The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions and causes an increase in the endogenous mutation level. For example, in E. coli, a low fidelity DNA polymerase, pol V, copies lesions that block replication fork progress. This produces mutations specifically targeted to DNA template damage sites, but it can also produce mutations at undamaged sites.
	GO:0009411	response to UV	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
	GO:0019985	translesion synthesis	The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (POLH_HUMAN | Q9Y253)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003887	DNA-directed DNA polymerase activity	Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template and a 3'hydroxyl group.
	GO:0003684	damaged DNA binding	Interacting selectively and non-covalently with damaged DNA.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0071897	DNA biosynthetic process	The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0000731	DNA synthesis involved in DNA repair	Synthesis of DNA that proceeds from the broken 3' single-strand DNA end and uses the homologous intact duplex as the template.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0071494	cellular response to UV-C	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-C radiation stimulus. UV-C radiation (UV-C light) spans the wavelengths 100 to 280 nm.
	GO:0070987	error-free translesion synthesis	The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions but does not causes an increase in the endogenous mutation level. For S. cerevisiae, RAD30 encodes DNA polymerase eta, which incorporates two adenines. When incorporated across a thymine-thymine dimer, it does not increase the endogenous mutation level.
	GO:0006301	postreplication repair	The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication. Includes pathways that remove replication-blocking lesions in conjunction with DNA replication.
	GO:0006290	pyrimidine dimer repair	The repair of UV-induced T-T, C-T and C-C dimers.
	GO:0006282	regulation of DNA repair	Any process that modulates the frequency, rate or extent of DNA repair.
	GO:0010225	response to UV-C	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-C radiation stimulus. UV-C radiation (UV-C light) spans the wavelengths 100 to 280 nm.
	GO:0019985	translesion synthesis	The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lsk)

	Sites
(no "Sites" information available for 2lsk)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lsk)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2lsk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	POLH_HUMAN \| Q9Y253
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	REV1_HUMAN \| Q9UBZ9
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	278750
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	POLH_HUMAN \| Q9Y253
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	REV1_HUMAN \| Q9UBZ9
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (0, 0)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (25, 38)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File