Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE BRCT DOMAIN FROM HUMAN DNA REPAIR PROTEIN REV1
 
Authors :  T. Nagashima, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  09 Feb 07  (Deposition) - 14 Aug 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  A/B/A 3 Layers, Parallel Beta-Sheet, Dna Replication, Translession Synthesis, Tls, Dna Polymerase Zeta, Pcna, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Nagashima, F. Hayashi, S. Yokoyama
Solution Structure Of The Brct Domain From Human Dna Repair Protein Rev1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA REPAIR PROTEIN REV1
    ChainsA
    EC Number2.7.7.-
    EngineeredYES
    Expression System PlasmidP060821-10
    Expression System Vector TypePLASMID
    FragmentBRCT DOMAIN
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS
    SynonymREV1-LIKE TERMINAL DEOXYCYTIDYL TRANSFERASE, ALPHA INTEGRIN-BINDING PROTEIN 80, AIBP80

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2EBW)

(-) Sites  (0, 0)

(no "Site" information available for 2EBW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2EBW)

(-) Cis Peptide Bonds  (1, 20)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20Asp A:61 -Pro A:62

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EBW)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BRCTPS50172 BRCT domain profile.REV1_HUMAN44-131  1A:44-131

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002584281aENSE00001515354chr2:100106497-100106279219REV1_HUMAN-00--
1.2ENST000002584282ENSE00000921861chr2:100081447-10008138464REV1_HUMAN1-18180--
1.3bENST000002584283bENSE00000921860chr2:100079084-100078958127REV1_HUMAN19-61431A:37-6125
1.5ENST000002584285ENSE00001637671chr2:100065966-100065798169REV1_HUMAN61-117571A:61-11757
1.6ENST000002584286ENSE00001757863chr2:100058931-100058779153REV1_HUMAN117-168521A:117-13317
1.7aENST000002584287aENSE00001698319chr2:100055772-100055063710REV1_HUMAN168-4052380--
1.9bENST000002584289bENSE00001623485chr2:100052403-100052296108REV1_HUMAN405-441370--
1.10ENST0000025842810ENSE00001751683chr2:100050910-100050794117REV1_HUMAN441-480400--
1.12aENST0000025842812aENSE00000921854chr2:100046410-100046302109REV1_HUMAN480-516370--
1.14bENST0000025842814bENSE00001685794chr2:100040742-100040614129REV1_HUMAN516-559440--
1.15ENST0000025842815ENSE00001749185chr2:100038115-100037961155REV1_HUMAN559-611530--
1.16bENST0000025842816bENSE00001690779chr2:100035409-100035290120REV1_HUMAN611-651410--
1.17bENST0000025842817bENSE00001626429chr2:100029413-100029193221REV1_HUMAN651-724740--
1.18aENST0000025842818aENSE00001733763chr2:100027329-100027157173REV1_HUMAN725-782580--
1.19bENST0000025842819bENSE00001627924chr2:100024593-100024491103REV1_HUMAN782-816350--
1.20bENST0000025842820bENSE00001802837chr2:100022952-100022787166REV1_HUMAN817-872560--
1.20hENST0000025842820hENSE00001790412chr2:100022568-100022372197REV1_HUMAN872-937660--
1.21ENST0000025842821ENSE00001641934chr2:100021140-100020907234REV1_HUMAN938-1015780--
1.22ENST0000025842822ENSE00001774065chr2:100020278-100020158121REV1_HUMAN1016-1056410--
1.23dENST0000025842823dENSE00001793684chr2:100019569-100019352218REV1_HUMAN1056-1128730--
1.24aENST0000025842824aENSE00000921842chr2:100019263-100019107157REV1_HUMAN1129-1181530--
1.24eENST0000025842824eENSE00000921841chr2:100018809-100018707103REV1_HUMAN1181-1215350--
1.25bENST0000025842825bENSE00000921840chr2:100017815-100016938878REV1_HUMAN1215-1251370--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:97
 aligned with REV1_HUMAN | Q9UBZ9 from UniProtKB/Swiss-Prot  Length:1251

    Alignment length:97
                                    46        56        66        76        86        96       106       116       126       
           REV1_HUMAN    37 AAMQKDGTSSTIFSGVAIYVNGYTDPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKAGRLLSYIPYQLYT 133
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeee......hhhhhhhhhhhh..ee..........eee......hhhhhh.......hhhhhhhhhhh....hhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------BRCT  PDB: A:44-131 UniProt: 44-131                                                     -- PROSITE
           Transcript 1 (1) Exon 1.3b  PDB: A:37-61  -------------------------------------------------------Exon 1.6          Transcript 1 (1)
           Transcript 1 (2) ------------------------Exon 1.5  PDB: A:61-117 UniProt: 61-117                  ---------------- Transcript 1 (2)
                 2ebw A  37 GSSGSSGTSSTIFSGVAIYVNGYTDPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKAGRLLSYIPYQLYT 133
                                    46        56        66        76        86        96       106       116       126       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2EBW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2EBW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EBW)

(-) Gene Ontology  (16, 16)

NMR Structure(hide GO term definitions)
Chain A   (REV1_HUMAN | Q9UBZ9)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003684    damaged DNA binding    Interacting selectively and non-covalently with damaged DNA.
    GO:0017125    deoxycytidyl transferase activity    Catalysis of the insertion of a dCMP residue opposite a template abasic site in DNA.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0071897    DNA biosynthetic process    The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0042276    error-prone translesion synthesis    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication by using a specialized DNA polymerase or replication complex to insert a defined nucleotide across the lesion. This process does not remove the replication-blocking lesions and causes an increase in the endogenous mutation level. For example, in E. coli, a low fidelity DNA polymerase, pol V, copies lesions that block replication fork progress. This produces mutations specifically targeted to DNA template damage sites, but it can also produce mutations at undamaged sites.
    GO:0009411    response to UV    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ultraviolet radiation (UV light) stimulus. Ultraviolet radiation is electromagnetic radiation with a wavelength in the range of 10 to 380 nanometers.
    GO:0019985    translesion synthesis    The replication of damaged DNA by synthesis across a lesion in the template strand; a specialized DNA polymerase or replication complex inserts a defined nucleotide across from the lesion which allows DNA synthesis to continue beyond the lesion. This process can be mutagenic depending on the damaged nucleotide and the inserted nucleotide.
cellular component
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ebw)
 
  Sites
(no "Sites" information available for 2ebw)
 
  Cis Peptide Bonds
    Asp A:61 - Pro A:62   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ebw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  REV1_HUMAN | Q9UBZ9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  REV1_HUMAN | Q9UBZ9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        REV1_HUMAN | Q9UBZ92lsi 2lsk 2lsy 2n1g 3gqc 3vu7 4ba9 4ext 4gk0 4gk5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2EBW)