Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF F153W CARDIAC TROPONIN C
 
Authors :  X. Wang, P. Mercier, P. Letourneau, B. D. Sykes
Date :  18 Jul 07  (Deposition) - 31 Jul 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Ef-Hand Protein, Calcium-Bind Protein, Phe-To-Trp Mutation, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  X. Wang, P. Mercier, P. J. Letourneau, B. D. Sykes
Effects Of Phe-To-Trp Mutation And Fluorotryptophan Incorporation On The Solution Structure Of Cardiac Troponin C, And Analysis Of Its Suitability As A Potential Probe For In Situ Nmr Studies.
Protein Sci. V. 14 2447 2005
PubMed-ID: 16131667  |  Reference-DOI: 10.1110/PS.051595805
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TROPONIN C
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Variant: (DE3)PLYSS
    Expression System Vector: PET-21
    Expression System Vector Type: VECTOR
    Gene: TNNC1, TNNC
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: TN-C

 Structural Features

(-) Chains, Units

  
NMR Structure (10x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JT3)

(-) Sites  (0, 0)

(no "Site" information available for 2JT3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JT3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JT3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (6, 6)

NMR Structure (6, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_063070A8VTNNC1_HUMANDisease (CMH13)267607125AA8V
2UniProtVAR_019776L29QTNNC1_HUMANDisease (CMH13)267607123AL29Q
3UniProtVAR_063071C84YTNNC1_HUMANDisease (CMH13)267607126AS84Y
4UniProtVAR_063072E134DTNNC1_HUMANDisease (CMH13)397516847AE134D
5UniProtVAR_063073D145ETNNC1_HUMANDisease (CMH13)267607124AD145E
6UniProtVAR_043988G159RTNNC1_HUMANDisease (CMD1Z)  ---AG159R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 7)

NMR Structure (2, 7)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.TNNC1_HUMAN33-51
52-87
92-127
128-161
  4A:33-51
A:52-87
A:92-127
A:128-161
2EF_HAND_1PS00018 EF-hand calcium-binding domain.TNNC1_HUMAN65-77
105-117
141-153
  3A:65-77
A:105-117
A:141-152

(-) Exons   (6, 6)

NMR Structure (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002329751ENSE00001063786chr3:52488086-5248800879TNNC1_HUMAN1-881A:1-88
1.2bENST000002329752bENSE00000770833chr3:52486529-5248649931TNNC1_HUMAN9-19111A:9-1911
1.3ENST000002329753ENSE00000770832chr3:52486268-52486122147TNNC1_HUMAN19-68501A:19-6850
1.4bENST000002329754bENSE00000770831chr3:52485874-52485760115TNNC1_HUMAN68-106391A:68-10639
1.5cENST000002329755cENSE00000770830chr3:52485543-52485407137TNNC1_HUMAN106-152471A:106-15247
1.6ENST000002329756ENSE00001063787chr3:52485322-52485118205TNNC1_HUMAN152-161101A:152-16110

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:161
 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:161
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160 
          TNNC1_HUMAN     1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 161
               SCOP domains d2jt3a_ A: automated matches                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------EF_hand_5-2jt3A01 A:93-157                                       ---- Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------EF_hand_6-2jt3A02 A:117-159                -- Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------EF_hand_6-2jt3A03 A:117-159                -- Pfam domains (3)
         Sec.struct. author ..hhhhhhhhhhhhhhhhh...hhhhhhhhh........hhhhhhhhhh...hhhhhhhhhhhhh.......hhhhhhhhhhhh........hhhhhhhhhhhh.........hhhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------V--------------------Q------------------------------------------------------Y-------------------------------------------------D----------E-------------R-- SAPs(SNPs)
                PROSITE (1) --------------------------------EF_HAND_2          EF_HAND_2  PDB: A:52-87             ----EF_HAND_2  PDB: A:92-127            EF_HAND_2  PDB: A:128-161          PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------EF_HAND_1    ---------------------------EF_HAND_1    -----------------------EF_HAND_1    -------- PROSITE (2)
           Transcript 1 (1) Exon 1.1Exon 1.2b  ------------------------------------------------Exon 1.4b  PDB: A:68-106               ---------------------------------------------Exon 1.6   Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.3  PDB: A:19-68 UniProt: 19-68             -------------------------------------Exon 1.5c  PDB: A:106-152 UniProt: 106-152     --------- Transcript 1 (2)
                 2jt3 A   1 MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEWLEFMKGVE 161
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JT3)

(-) Pfam Domains  (2, 3)

NMR Structure
(-)
Clan: EF_hand (270)

(-) Gene Ontology  (23, 23)

NMR Structure(hide GO term definitions)
Chain A   (TNNC1_HUMAN | P63316)
molecular function
    GO:0051015    actin filament binding    Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0048306    calcium-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0031013    troponin I binding    Interacting selectively and non-covalently with troponin I, the inhibitory subunit of the troponin complex.
    GO:0031014    troponin T binding    Interacting selectively and non-covalently with troponin T, the tropomyosin-binding subunit of the troponin complex.
biological process
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0002086    diaphragm contraction    A process in which force is generated within involuntary skeletal muscle tissue, resulting in a change in muscle geometry. This process occurs in the diaphragm. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. The diaphragm is a striated muscle that is necessary for the process of respiratory gaseous exchange.
    GO:0030049    muscle filament sliding    The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
    GO:0043462    regulation of ATPase activity    Any process that modulates the rate of ATP hydrolysis by an ATPase.
    GO:0006937    regulation of muscle contraction    Any process that modulates the frequency, rate or extent of muscle contraction.
    GO:0032972    regulation of muscle filament sliding speed    Any process that modulates the velocity of muscle filament sliding.
    GO:0010038    response to metal ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
    GO:0014883    transition between fast and slow fiber    The process of conversion of fast-contracting muscle fibers to a slower character. This may involve slowing of contractile rate, slow myosin gene induction, increase in oxidative metabolic properties, altered electrophysiology and altered innervation. This process also regulates skeletal muscle adapatation.
    GO:0055010    ventricular cardiac muscle tissue morphogenesis    The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0043292    contractile fiber    Fibers, composed of actin, myosin, and associated proteins, found in cells of smooth or striated muscle.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005861    troponin complex    A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jt3)
 
  Sites
(no "Sites" information available for 2jt3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jt3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jt3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNNC1_HUMAN | P63316
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  611879
    Disease Information: OMIM
  613243
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TNNC1_HUMAN | P63316
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNNC1_HUMAN | P63316: 1ap4 1ih0 1j1d 1j1e 1lj6 1lxf 1mxl 1ozs 1spy 1wrk 1wrl 2jt0 2jt8 2jtz 2jxl 2kdh 2kfx 2kgb 2krd 2l1r 2l98 2mkp 2mle 2mlf 2mzp 2n79 2n7l 3rv5 3sd6 3swb 4gje 4gjf 4gjg 4y99 5vln 5w88

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JT3)