2FFV - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   HUMAN PPGALNACT-2 COMPLEXED WITH MANGANESE AND UDP

Authors :   T. A. Fritz

Date :   20 Dec 05 (Deposition) - 31 Jan 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.75

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: A,B  (2x)

Keywords :   Ppgalnact; Mucin; Glycosyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. A. Fritz, J. Raman, L. A. Tabak
Dynamic Association Between The Catalytic And Lectin Domain Of Human Udp-Galnac:Polypeptide {Alpha}-N-Acetylgalactosaminyltransferase-2
J. Biol. Chem. V. 281 8613 2006
PubMed-ID: 16434399 | Reference-DOI: 10.1074/JBC.M513590200

Molecule 1 - POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 2
	Chains	:	A, B
	EC Number	:	2.4.1.41
	Engineered	:	YES
	Expression System	:	PICHIA PASTORIS
	Expression System Plasmid	:	PPIC9
	Expression System Strain	:	SMD1168
	Expression System Taxid	:	4922
	Expression System Vector Type	:	PLASMID
	Fragment	:	CATALYTIC AND LECTIN DOMAINS
	Gene	:	GALNT2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	INVITROGEN PPIC9 VECTOR WITH TEV-PROTEASE-CLEAVABLE, N-TERMINAL ENGINEERED 6HIS TAG
	Synonym	:	PPGALNACT-2; PROTEIN-UDP ACETYLGALACTOSAMINYLTRANSFERASE 2
	Udp-galnac	:	POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 2

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	MN	2	Ligand/Ion	MANGANESE (II) ION
2	UDP	2	Ligand/Ion	URIDINE-5'-DIPHOSPHATE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	MN	-1	Ligand/Ion	MANGANESE (II) ION
2	UDP	1	Ligand/Ion	URIDINE-5'-DIPHOSPHATE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	MN	-1	Ligand/Ion	MANGANESE (II) ION
2	UDP	1	Ligand/Ion	URIDINE-5'-DIPHOSPHATE

Biological Unit 3 (1, 4)

No.	Name	Count	Type	Full Name
1	MN	-1	Ligand/Ion	MANGANESE (II) ION
2	UDP	4	Ligand/Ion	URIDINE-5'-DIPHOSPHATE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:224 , HIS A:226 , HIS A:359 , UDP A:5601	BINDING SITE FOR RESIDUE MN A 5600
2	AC2	SOFTWARE	ASP B:224 , HIS B:226 , HIS B:359 , UDP B:9601	BINDING SITE FOR RESIDUE MN B 9600
3	AC3	SOFTWARE	THR A:143 , PHE A:144 , HIS A:145 , ASP A:176 , ARG A:201 , GLY A:203 , LEU A:204 , SER A:207 , ASP A:224 , HIS A:226 , VAL A:330 , HIS A:359 , ARG A:362 , HIS A:365 , MN A:5600	BINDING SITE FOR RESIDUE UDP A 5601
4	AC4	SOFTWARE	THR B:143 , PHE B:144 , ASP B:176 , ARG B:201 , GLY B:203 , LEU B:204 , ASP B:224 , HIS B:226 , VAL B:330 , HIS B:359 , ARG B:362 , HIS B:365 , MN B:9600	BINDING SITE FOR RESIDUE UDP B 9601

Asymmetric Unit

No.	Residues
1	A:126	-	A:354
2	A:345	-	A:423
3	A:456	-	A:473
4	A:496	-	A:513
5	A:539	-	A:555
6	B:126	-	B:354
7	B:345	-	B:423
8	B:456	-	B:473
9	B:496	-	B:513
10	B:539	-	B:555

(no "Cis Peptide Bond" information available for 2FFV)

Asymmetric Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049240	R	245	H	GALT2_HUMAN	Polymorphism	1923950	A/B	R	245	H
2	UniProt	VAR_019575	V	554	M	GALT2_HUMAN	Polymorphism	2273970	A/B	V	554	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049240	R	245	H	GALT2_HUMAN	Polymorphism	1923950	A	R	245	H
2	UniProt	VAR_019575	V	554	M	GALT2_HUMAN	Polymorphism	2273970	A	V	554	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049240	R	245	H	GALT2_HUMAN	Polymorphism	1923950	B	R	245	H
2	UniProt	VAR_019575	V	554	M	GALT2_HUMAN	Polymorphism	2273970	B	V	554	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049240	R	245	H	GALT2_HUMAN	Polymorphism	1923950	A/B	R	245	H
2	UniProt	VAR_019575	V	554	M	GALT2_HUMAN	Polymorphism	2273970	A/B	V	554	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RICIN_B_LECTIN	PS50231	Lectin domain of ricin B chain profile.	GALT2_HUMAN	456-566	2	A:456-566 B:456-566

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RICIN_B_LECTIN	PS50231	Lectin domain of ricin B chain profile.	GALT2_HUMAN	456-566	1	A:456-566 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RICIN_B_LECTIN	PS50231	Lectin domain of ricin B chain profile.	GALT2_HUMAN	456-566	1	- B:456-566

Biological Unit 3 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RICIN_B_LECTIN	PS50231	Lectin domain of ricin B chain profile.	GALT2_HUMAN	456-566	4	A:456-566 B:456-566

Asymmetric Unit (15, 30)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000366672	2a	ENSE00001442291	chr1:230202956-230203153	198	GALT2_HUMAN	1-42	42	0	-	-
1.4	ENST00000366672	4	ENSE00001007552	chr1:230313964-230314057	94	GALT2_HUMAN	43-74	32	2	A:72-74 B:74-74	3 1
1.5	ENST00000366672	5	ENSE00001007567	chr1:230338883-230339036	154	GALT2_HUMAN	74-125	52	2	A:75-125 (gaps) B:74-125 (gaps)	51 52
1.6	ENST00000366672	6	ENSE00001007559	chr1:230371760-230371858	99	GALT2_HUMAN	125-158	34	2	A:125-158 B:125-158	34 34
1.7	ENST00000366672	7	ENSE00001007566	chr1:230372099-230372166	68	GALT2_HUMAN	158-181	24	2	A:158-181 B:158-181	24 24
1.8	ENST00000366672	8	ENSE00001007558	chr1:230372406-230372471	66	GALT2_HUMAN	181-203	23	2	A:181-203 B:181-203	23 23
1.9	ENST00000366672	9	ENSE00001007570	chr1:230379052-230379173	122	GALT2_HUMAN	203-243	41	2	A:203-243 B:203-243	41 41
1.10	ENST00000366672	10	ENSE00001007561	chr1:230381809-230381896	88	GALT2_HUMAN	244-273	30	2	A:244-273 B:244-273	30 30
1.11	ENST00000366672	11	ENSE00001007560	chr1:230384930-230385017	88	GALT2_HUMAN	273-302	30	2	A:273-302 B:273-302	30 30
1.12	ENST00000366672	12	ENSE00001007564	chr1:230386203-230386306	104	GALT2_HUMAN	302-337	36	2	A:302-337 B:302-337	36 36
1.13	ENST00000366672	13	ENSE00001007554	chr1:230390964-230391090	127	GALT2_HUMAN	337-379	43	2	A:337-379 B:337-379	43 43
1.15c	ENST00000366672	15c	ENSE00001007562	chr1:230398319-230398411	93	GALT2_HUMAN	379-410	32	2	A:379-410 B:379-410	32 32
1.16a	ENST00000366672	16a	ENSE00001007556	chr1:230398668-230398751	84	GALT2_HUMAN	410-438	29	2	A:410-438 B:410-438	29 29
1.17	ENST00000366672	17	ENSE00001007563	chr1:230400987-230401113	127	GALT2_HUMAN	438-480	43	2	A:438-480 (gaps) B:438-480 (gaps)	43 43
1.18	ENST00000366672	18	ENSE00001007568	chr1:230410191-230410310	120	GALT2_HUMAN	481-520	40	2	A:481-520 B:481-520	40 40
1.19b	ENST00000366672	19b	ENSE00001935591	chr1:230415049-230417870	2822	GALT2_HUMAN	521-571	51	2	A:521-570 B:521-570	50 50

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:489
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:502
                                    78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568  
          GALT2_HUMAN    69 ETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ 570
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...---..hhhhhhhhhhhhh--------.hhhhh.hhhhhhhh..........hhhhhh.........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhh......eeeee....hhhhhhhhhhhhhh...eeeeee..eee...hhhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhhhh....ee........eeeehhhhhhh...........hhhhhhhhhhhhh..eeeeeeeeeeeee.................hhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhh............eeeeeee..eeee.......ee.eeee...--....eee.....eee..eeee..........eeee....hhhh.eeee....eeee....eeee..hhhhh..eeee...hhhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M---------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RICIN_B_LECTIN  PDB: A:456-566 UniProt: 456-566                                                                ---- PROSITE
           Transcript 1 (1) 1.4   --------------------------------------------------Exon 1.6  PDB: A:125-158          ----------------------Exon 1.8  PDB: A:181-20----------------------------------------Exon 1.10  PDB: A:244-273     ----------------------------Exon 1.12  PDB: A:302-337           -----------------------------------------Exon 1.15c  PDB: A:379-410      ---------------------------Exon 1.17  PDB: A:438-480 (gaps)           Exon 1.18  PDB: A:481-520               Exon 1.19b  PDB: A:521-570 UniProt: 521-571        Transcript 1 (1)
           Transcript 1 (2) -----Exon 1.5  PDB: A:75-125 (gaps) UniProt: 74-125      --------------------------------Exon 1.7  PDB: A:158-181---------------------Exon 1.9  PDB: A:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: A:273-302     ----------------------------------Exon 1.13  PDB: A:337-379 UniProt: 337-379 ------------------------------Exon 1.16a  PDB: A:410-438   ------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2ffv A  72 DAL---KVRWPDFNQEAYVGG--------PYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHN--GNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ 570
                              |   | 78        88|       98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468      |478       488       498       508       518       528       538       548       558       568  
                             74  75            89       98                                                                                                                                                                                                                                                                                                                                                                                      475  |                                                                                            
                                                                                                                                                                                                                                                                                                                                                                                                                                                   478

Chain B from PDB  Type:PROTEIN  Length:481
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:497
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       
          GALT2_HUMAN    74 GKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ 570
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhh.--------------.hhhhhhhh..........hhhhhh.........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhh......eeeee....hhhhhhhhhhhhh....eeeee...eee....hhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhhhh....ee........eeeehhhhhhh...........hhhhhhhhhhhhh..eeeeeeeeeeeee................hhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhh..........eeeeeeeee..eeee..........eeee...--....eeee....eee..eeee..........eeee....hhhh.eeee....eeee....eeee.........eeee...hhhhh.eeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M---------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RICIN_B_LECTIN  PDB: B:456-566 UniProt: 456-566                                                                ---- PROSITE
           Transcript 1 (1) 1--------------------------------------------------Exon 1.6  PDB: B:125-158          ----------------------Exon 1.8  PDB: B:181-20----------------------------------------Exon 1.10  PDB: B:244-273     ----------------------------Exon 1.12  PDB: B:302-337           -----------------------------------------Exon 1.15c  PDB: B:379-410      ---------------------------Exon 1.17  PDB: B:438-480 (gaps)           Exon 1.18  PDB: B:481-520               Exon 1.19b  PDB: B:521-570 UniProt: 521-571        Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: B:74-125 (gaps) UniProt: 74-125      --------------------------------Exon 1.7  PDB: B:158-181---------------------Exon 1.9  PDB: B:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: B:273-302     ----------------------------------Exon 1.13  PDB: B:337-379 UniProt: 337-379 ------------------------------Exon 1.16a  PDB: B:410-438   ------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2ffv B  74 LKVRWPDFNQEAYVGG--------------FNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHN--GNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ 570
                                    83     |   -         -|      113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473 |  |  483       493       503       513       523       533       543       553       563       
                                          89            104                                                                                                                                                                                                                                                                                                                                                                                475  |                                                                                            
                                                                                                                                                                                                                                                                                                                                                                                                                                              478

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2FFV)

(no "CATH Domain" information available for 2FFV)

(no "Pfam Domain" information available for 2FFV)

Asymmetric Unit(hide GO term definitions)

Chain A,B (GALT2_HUMAN | Q10471)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0030145	manganese ion binding	Interacting selectively and non-covalently with manganese (Mn) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004653	polypeptide N-acetylgalactosaminyltransferase activity	Catalysis of the reaction: UDP-N-acetyl-D-galactosamine + polypeptide = UDP + N-acetyl-D-galactosaminyl-polypeptide. This reaction is the modification of serine or threonine residues in polypeptide chains by the transfer of a N-acetylgalactose from UDP-N-acetylgalactose to the hydroxyl group of the amino acid; it is the first step in O-glycan biosynthesis.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
biological process
	GO:0016266	O-glycan processing	The stepwise addition of carbohydrate or carbohydrate derivative residues to the initially added O-linked residue (usually GalNAc) to form a core O-glycan structure.
	GO:0002378	immunoglobulin biosynthetic process	The chemical reactions and pathways resulting in the formation of immunoglobulin.
	GO:0006493	protein O-linked glycosylation	A protein glycosylation process in which a carbohydrate or carbohydrate derivative unit is added to a protein via the hydroxyl group of peptidyl-serine, peptidyl-threonine, peptidyl-hydroxylysine, or peptidyl-hydroxyproline, or via the phenol group of peptidyl-tyrosine, forming an O-glycan.
	GO:0018242	protein O-linked glycosylation via serine	The glycosylation of protein via the O3 atom of peptidyl-serine, forming O3-glycosyl-L-serine; the most common forms are N-acetylgalactosaminyl, mannosyl, galactosyl, and xylosyl serine.
	GO:0018243	protein O-linked glycosylation via threonine	The glycosylation of protein via the O3 atom of peptidyl-threonine, forming O3-glycosyl-L-threonine; the most common forms are N-acetylgalactosaminyl, mannosyl, and galactosyl threonine.
	GO:0006486	protein glycosylation	A protein modification process that results in the addition of a carbohydrate or carbohydrate derivative unit to a protein amino acid, e.g. the addition of glycan chains to proteins.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0032580	Golgi cisterna membrane	The lipid bilayer surrounding any of the thin, flattened compartments that form the central portion of the Golgi complex.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0005795	Golgi stack	The set of thin, flattened membrane-bounded compartments, called cisternae, that form the central portion of the Golgi complex. The stack usually comprises cis, medial, and trans cisternae; the cis- and trans-Golgi networks are not considered part of the stack.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0030173	integral component of Golgi membrane	The component of the Golgi membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ffv)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ffv
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GALT2_HUMAN \| Q10471
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.4.1.41
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GALT2_HUMAN \| Q10471
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GALT2_HUMAN \| Q10471	:	2ffu 4d0t 4d0z 4d11 5ajn 5ajo 5ajp 5fv9

(no "Related Entries Specified in the PDB File" available for 2FFV)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (10, 10)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (1, 2)

Exons (15, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (24, 24)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File