4D11 - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:491
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:495
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564     
          GALT2_HUMAN    75 KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL 569
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh...............hhhhhhhh..........hhhhhh.........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhhhhh...eeeee.....hhhhhhhhhhhhh...eeeee...eee....hhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhh......ee........eeeehhhhhhh...........hhhhhhhhhhhhh..eeeeeeeeeeeee.......----hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhh............eeeeeee..eeee..........eeee.........eee.....eee..eeee..........eeee....hhhh.eeee....eeee....eeee..hhhhh..eeee...hhhh..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M--------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RICIN_B_LECTIN  PDB: A:456-566 UniProt: 456-566                                                                --- PROSITE
           Transcript 1 (1) --------------------------------------------------Exon 1.6  PDB: A:125-158          ----------------------Exon 1.8  PDB: A:181-20----------------------------------------Exon 1.10  PDB: A:244-273     ----------------------------Exon 1.12  PDB: A:302-337           -----------------------------------------Exon 1.15c  PDB: A:379-410      ---------------------------Exon 1.17  PDB: A:438-480 UniProt: 438-480 Exon 1.18  PDB: A:481-520               Exon 1.19b  PDB: A:521-569 UniProt: 521-571       Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: A:75-125 UniProt: 74-125            --------------------------------Exon 1.7  PDB: A:158-181---------------------Exon 1.9  PDB: A:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: A:273-302     ----------------------------------Exon 1.13  PDB: A:337-379 (gaps)           ------------------------------Exon 1.16a  PDB: A:410-438   ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4d11 A  75 KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPY----GSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCREDDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL 569
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364  |    374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564     
                                                                                                                                                                                                                                                                                                                              367  372

Chain B from PDB  Type:PROTEIN  Length:482
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:496
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564      
          GALT2_HUMAN    75 KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ 570
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.-------........hhhhhhhh..........hhhhhh.........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhhhhhh..eeeee.....hhhhhhhhhhhhh...eeeee...eee....hhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhh......ee........eeeehhhhhhh...........hhhhhhhhhhhhh..eeeeeeeeeeeee......-------.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhh............eeeeeee..eeee..........eeee.........eee.....eee..eeee..........eeee....hhhh.eeee....eeee....eeee..hhhhh..eeee...hhhh..eeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M---------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RICIN_B_LECTIN  PDB: B:456-566 UniProt: 456-566                                                                ---- PROSITE
           Transcript 1 (1) --------------------------------------------------Exon 1.6  PDB: B:125-158          ----------------------Exon 1.8  PDB: B:181-20----------------------------------------Exon 1.10  PDB: B:244-273     ----------------------------Exon 1.12  PDB: B:302-337           -----------------------------------------Exon 1.15c  PDB: B:379-410      ---------------------------Exon 1.17  PDB: B:438-480 UniProt: 438-480 Exon 1.18  PDB: B:481-520               Exon 1.19b  PDB: B:521-570 UniProt: 521-571        Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: B:75-125 (gaps) UniProt: 74-125     --------------------------------Exon 1.7  PDB: B:158-181---------------------Exon 1.9  PDB: B:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: B:273-302     ----------------------------------Exon 1.13  PDB: B:337-379 (gaps)           ------------------------------Exon 1.16a  PDB: B:410-438   ------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 4d11 B  75 KVRWPDFNQEAYVGG-------DPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHP-------GTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCREDDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQ 570
                                    84    |    -  |    104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364 |     374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564      
                                         89      97                                                                                                                                                                                                                                                                          366     374

Chain C from PDB  Type:PROTEIN  Length:436
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:496
                                    83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563      
          GALT2_HUMAN    74 GKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL 569
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh.--------.......hhhhhhhh............hhhhh........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhhhhh...eeeee.....hhhhhhhhhhhh....eeeee...eee....hhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhh......ee........eeeehhhhhhh...........hhhhhhhhhhhhh..eeeeeeeeeeeee......-------hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhh............eeeeeee..ee......-------.ee.----....eee.....eee..eee.....------.eee.........eee......eee.----------------------------.eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RICIN_B_LECTIN  PDB: C:456-566 UniProt: 456-566                                                                --- PROSITE
           Transcript 1 (1) 1--------------------------------------------------Exon 1.6  PDB: C:125-158          ----------------------Exon 1.8  PDB: C:181-20----------------------------------------Exon 1.10  PDB: C:244-273     ----------------------------Exon 1.12  PDB: C:302-337           -----------------------------------------Exon 1.15c  PDB: C:379-410      ---------------------------Exon 1.17  PDB: C:438-480 (gaps)           Exon 1.18  PDB: C:481-520 (gaps)        Exon 1.19b  PDB: C:521-569 (gaps) [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: C:74-125 (gaps) UniProt: 74-125      --------------------------------Exon 1.7  PDB: C:158-181---------------------Exon 1.9  PDB: C:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: C:273-302     ----------------------------------Exon 1.13  PDB: C:337-379 (gaps)           ------------------------------Exon 1.16a  PDB: C:410-438   ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4d11 C  74 SKVRWPDFNQEAYVGG--------PYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHP-------GTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGH-------VYEC----GNQEWALTKEKSVKHMDLCLTVVDR------KLQGCREDDSRQKWEQIEGNSKLRHV----------------------------WKFTLNL 569
                                    83     |   -    |  103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363  |      -|      383       393       403       413       423       433       443       453        |-      |473    |  483       493        |-     | 513       523       533|        -         -       563      
                                          89       98                                                                                                                                                                                                                                                                         366     374                                                                                     462     470  |  478                     502    509                      534                          563      
                                                                                                                                                                                                                                                                                                                                                                                                                                         473

Chain D from PDB  Type:PROTEIN  Length:487
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:495
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564     
          GALT2_HUMAN    75 KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL 569
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh...............hhhhhhhh..........hhhhhhh........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhhhhh...eeeee....hhhhhhhhhhhhh....eeeee...eee....hhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhh......ee........eeeehhhhhhh...........hhhhhhhhhhhhh..eeeeeeeeeeeee........--------hhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhh............eeeeeee..eeee..........eeee.........eee.....eee..eeee..........eeee....hhhh.eeee....eeee....eeee..hhhhh..eeee...hhhh..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M--------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RICIN_B_LECTIN  PDB: D:456-566 UniProt: 456-566                                                                --- PROSITE
           Transcript 1 (1) --------------------------------------------------Exon 1.6  PDB: D:125-158          ----------------------Exon 1.8  PDB: D:181-20----------------------------------------Exon 1.10  PDB: D:244-273     ----------------------------Exon 1.12  PDB: D:302-337           -----------------------------------------Exon 1.15c  PDB: D:379-410      ---------------------------Exon 1.17  PDB: D:438-480 UniProt: 438-480 Exon 1.18  PDB: D:481-520               Exon 1.19b  PDB: D:521-569 UniProt: 521-571       Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: D:75-125 UniProt: 74-125            --------------------------------Exon 1.7  PDB: D:158-181---------------------Exon 1.9  PDB: D:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: D:273-302     ----------------------------------Exon 1.13  PDB: D:337-379 (gaps)           ------------------------------Exon 1.16a  PDB: D:410-438   ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4d11 D  75 KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYT--------FARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCREDDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL 569
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   |     -  |    384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564     
                                                                                                                                                                                                                                                                                                                               368      377

Chain E from PDB  Type:PROTEIN  Length:487
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:495
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564     
          GALT2_HUMAN    75 KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL 569
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh................hhhhhhhh..........hhhhhh.........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhhhhh...eeeee.....hhhhhhhhhhhh....eeeee...eee....hhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhh......ee........eeeehhhhhhh...........hhhhhhhhhhhhh..eeeeeeeeeeeee........--------..hhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhh............eeeeeee..eeee..........eeee.........eee.....eee..eeee..........eeee....hhhh.eeee....eeee....eeee..hhhhh..eeee...hhhh..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------M--------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RICIN_B_LECTIN  PDB: E:456-566 UniProt: 456-566                                                                --- PROSITE
           Transcript 1 (1) --------------------------------------------------Exon 1.6  PDB: E:125-158          ----------------------Exon 1.8  PDB: E:181-20----------------------------------------Exon 1.10  PDB: E:244-273     ----------------------------Exon 1.12  PDB: E:302-337           -----------------------------------------Exon 1.15c  PDB: E:379-410      ---------------------------Exon 1.17  PDB: E:438-480 UniProt: 438-480 Exon 1.18  PDB: E:481-520               Exon 1.19b  PDB: E:521-569 UniProt: 521-571       Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: E:75-125 UniProt: 74-125            --------------------------------Exon 1.7  PDB: E:158-181---------------------Exon 1.9  PDB: E:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: E:273-302     ----------------------------------Exon 1.13  PDB: E:337-379 (gaps)           ------------------------------Exon 1.16a  PDB: E:410-438   ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 4d11 E  75 KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYT--------FARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCREDDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNL 569
                                    84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364   |     -  |    384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564     
                                                                                                                                                                                                                                                                                                                               368      377

Chain F from PDB  Type:PROTEIN  Length:276
 aligned with GALT2_HUMAN | Q10471 from UniProtKB/Swiss-Prot  Length:571

    Alignment length:287
                                    85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       
          GALT2_HUMAN    76 VRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFR 362
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.....-----------.......hhhhhhhh..........hhhhhh.........eeeeeee...hhhhhhhhhhhhhhhhhhh.eeeeeeee.....hhhhhhhhhh..eeeee.....hhhhhhhhhhhhh...eeeee...eee....hhhhhhhhhhh..eeeeeeeeee......ee.....eeeee.....eeeee.hhhhhhhhh......ee........eeeehhhhhhh............hhhhhhhhhhhh..eeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------H--------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -------------------------------------------------Exon 1.6  PDB: F:125-158          ----------------------Exon 1.8  PDB: F:181-20----------------------------------------Exon 1.10  PDB: F:244-273     ----------------------------Exon 1.12  PDB: F:302-337           ------------------------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.5  PDB: F:76-125 (gaps) UniProt: 74-125    --------------------------------Exon 1.7  PDB: F:158-181---------------------Exon 1.9  PDB: F:203-243 UniProt: 203-243-----------------------------Exon 1.11  PDB: F:273-302     ----------------------------------Exon 1.13  PDB: F:337-362  Transcript 1 (2)
                 4d11 F  76 VRWPDFNQEAY-----------PYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFR 362
                                    85|        -  |    105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       
                                     86          98

Chain L from PDB  Type:PROTEIN  Length:6
 aligned with CYR61_HUMAN | O00622 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:6
          CYR61_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 L   5 STCPAA  10

Chain L from PDB  Type:PROTEIN  Length:6
 aligned with Q6FI18_HUMAN | Q6FI18 from UniProtKB/TrEMBL  Length:381

    Alignment length:6
         Q6FI18_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 L   5 STCPAA  10

Chain O from PDB  Type:PROTEIN  Length:6
 aligned with CYR61_HUMAN | O00622 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:6
          CYR61_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 O   5 STCPAA  10

Chain O from PDB  Type:PROTEIN  Length:6
 aligned with Q6FI18_HUMAN | Q6FI18 from UniProtKB/TrEMBL  Length:381

    Alignment length:6
         Q6FI18_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 O   5 STCPAA  10

Chain P from PDB  Type:PROTEIN  Length:6
 aligned with CYR61_HUMAN | O00622 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:6
          CYR61_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 P   5 STCPAA  10

Chain P from PDB  Type:PROTEIN  Length:6
 aligned with Q6FI18_HUMAN | Q6FI18 from UniProtKB/TrEMBL  Length:381

    Alignment length:6
         Q6FI18_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 P   5 STCPAA  10

Chain X from PDB  Type:PROTEIN  Length:6
 aligned with CYR61_HUMAN | O00622 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:6
          CYR61_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 X   5 STCPAA  10

Chain X from PDB  Type:PROTEIN  Length:6
 aligned with Q6FI18_HUMAN | Q6FI18 from UniProtKB/TrEMBL  Length:381

    Alignment length:6
         Q6FI18_HUMAN    24 STCPAA  29
               SCOP domains ------ SCOP domains
               CATH domains ------ CATH domains
               Pfam domains ------ Pfam domains
         Sec.struct. author ...... Sec.struct. author
                 SAPs(SNPs) ------ SAPs(SNPs)
                    PROSITE ------ PROSITE
                 Transcript ------ Transcript
                 4d11 X   5 STCPAA  10

Chain Z from PDB  Type:PROTEIN  Length:5
 aligned with CYR61_HUMAN | O00622 from UniProtKB/Swiss-Prot  Length:381

    Alignment length:5
          CYR61_HUMAN    24 STCPA  28
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4d11 Z   5 STCPA   9

Chain Z from PDB  Type:PROTEIN  Length:5
 aligned with Q6FI18_HUMAN | Q6FI18 from UniProtKB/TrEMBL  Length:381

    Alignment length:5
         Q6FI18_HUMAN    24 STCPA  28
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 4d11 Z   5 STCPA   9

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (GALT2_HUMAN | Q10471)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0030145	manganese ion binding	Interacting selectively and non-covalently with manganese (Mn) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004653	polypeptide N-acetylgalactosaminyltransferase activity	Catalysis of the reaction: UDP-N-acetyl-D-galactosamine + polypeptide = UDP + N-acetyl-D-galactosaminyl-polypeptide. This reaction is the modification of serine or threonine residues in polypeptide chains by the transfer of a N-acetylgalactose from UDP-N-acetylgalactose to the hydroxyl group of the amino acid; it is the first step in O-glycan biosynthesis.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
biological process
	GO:0016266	O-glycan processing	The stepwise addition of carbohydrate or carbohydrate derivative residues to the initially added O-linked residue (usually GalNAc) to form a core O-glycan structure.
	GO:0002378	immunoglobulin biosynthetic process	The chemical reactions and pathways resulting in the formation of immunoglobulin.
	GO:0006493	protein O-linked glycosylation	A protein glycosylation process in which a carbohydrate or carbohydrate derivative unit is added to a protein via the hydroxyl group of peptidyl-serine, peptidyl-threonine, peptidyl-hydroxylysine, or peptidyl-hydroxyproline, or via the phenol group of peptidyl-tyrosine, forming an O-glycan.
	GO:0018242	protein O-linked glycosylation via serine	The glycosylation of protein via the O3 atom of peptidyl-serine, forming O3-glycosyl-L-serine; the most common forms are N-acetylgalactosaminyl, mannosyl, galactosyl, and xylosyl serine.
	GO:0018243	protein O-linked glycosylation via threonine	The glycosylation of protein via the O3 atom of peptidyl-threonine, forming O3-glycosyl-L-threonine; the most common forms are N-acetylgalactosaminyl, mannosyl, and galactosyl threonine.
	GO:0006486	protein glycosylation	A protein modification process that results in the addition of a carbohydrate or carbohydrate derivative unit to a protein amino acid, e.g. the addition of glycan chains to proteins.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0032580	Golgi cisterna membrane	The lipid bilayer surrounding any of the thin, flattened compartments that form the central portion of the Golgi complex.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0005795	Golgi stack	The set of thin, flattened membrane-bounded compartments, called cisternae, that form the central portion of the Golgi complex. The stack usually comprises cis, medial, and trans cisternae; the cis- and trans-Golgi networks are not considered part of the stack.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0030173	integral component of Golgi membrane	The component of the Golgi membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.

Chain L,O,P,X,Z (Q6FI18_HUMAN | Q6FI18)

molecular function
	GO:0050840	extracellular matrix binding	Interacting selectively and non-covalently with a component of the extracellular matrix.
	GO:0005520	insulin-like growth factor binding	Interacting selectively and non-covalently with an insulin-like growth factor, any member of a group of polypeptides that are structurally homologous to insulin and share many of its biological activities, but are immunologically distinct from it.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0003278	apoptotic process involved in heart morphogenesis	Any apoptotic process that contributes to the shaping of the heart.
	GO:0060413	atrial septum morphogenesis	The developmental process in which atrial septum is generated and organized. The atrial septum separates the upper chambers (the atria) of the heart from one another.
	GO:0003181	atrioventricular valve morphogenesis	The process in which the structure of the atrioventricular valve is generated and organized.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0060591	chondroblast differentiation	The process in which a mesenchymal cell, acquires specialized structural and/or functional features of a chondroblast. Differentiation includes the processes involved in commitment of a cell to a chondroblast fate. A chondroblast is a precursor cell to chondrocytes.
	GO:0060710	chorio-allantoic fusion	The cell-cell adhesion process in which the cells of the chorion fuse to the cells of the allantois.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0002041	intussusceptive angiogenesis	The formation of new blood vessels as a result of the insertion and extension of lumenal tissue pillars.
	GO:0060716	labyrinthine layer blood vessel development	The process whose specific outcome is the progression of a blood vessel of the labyrinthine layer of the placenta over time, from its formation to the mature structure. The embryonic vessels grow through the layer to come in close contact with the maternal blood supply.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0001649	osteoblast differentiation	The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0061036	positive regulation of cartilage development	Any process that increases the rate, frequency, or extent of cartilage development, the process whose specific outcome is the progression of the cartilage over time, from its formation to the mature structure. Cartilage is a connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
	GO:0045597	positive regulation of cell differentiation	Any process that activates or increases the frequency, rate or extent of cell differentiation.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0010811	positive regulation of cell-substrate adhesion	Any process that increases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
	GO:2000304	positive regulation of ceramide biosynthetic process	Any process that activates or increases the frequency, rate or extent of ceramide biosynthetic process.
	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that activates or increases the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0010518	positive regulation of phospholipase activity	Any process that increases the frequency, rate or extent of phospholipase activity, the hydrolysis of a phospholipid.
	GO:0072593	reactive oxygen species metabolic process	The chemical reactions and pathways involving a reactive oxygen species, any molecules or ions formed by the incomplete one-electron reduction of oxygen. They contribute to the microbicidal activity of phagocytes, regulation of signal transduction and gene expression, and the oxidative damage to biopolymers.
	GO:0001558	regulation of cell growth	Any process that modulates the frequency, rate, extent or direction of cell growth.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
	GO:0003281	ventricular septum development	The progression of the ventricular septum over time from its formation to the mature structure.
cellular component
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain L,O,P,X,Z (CYR61_HUMAN | O00622)

molecular function
	GO:0050840	extracellular matrix binding	Interacting selectively and non-covalently with a component of the extracellular matrix.
	GO:0019838	growth factor binding	Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0005520	insulin-like growth factor binding	Interacting selectively and non-covalently with an insulin-like growth factor, any member of a group of polypeptides that are structurally homologous to insulin and share many of its biological activities, but are immunologically distinct from it.
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
biological process
	GO:0009653	anatomical structure morphogenesis	The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
	GO:0003278	apoptotic process involved in heart morphogenesis	Any apoptotic process that contributes to the shaping of the heart.
	GO:0060413	atrial septum morphogenesis	The developmental process in which atrial septum is generated and organized. The atrial septum separates the upper chambers (the atria) of the heart from one another.
	GO:0003181	atrioventricular valve morphogenesis	The process in which the structure of the atrioventricular valve is generated and organized.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0006935	chemotaxis	The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
	GO:0060591	chondroblast differentiation	The process in which a mesenchymal cell, acquires specialized structural and/or functional features of a chondroblast. Differentiation includes the processes involved in commitment of a cell to a chondroblast fate. A chondroblast is a precursor cell to chondrocytes.
	GO:0060710	chorio-allantoic fusion	The cell-cell adhesion process in which the cells of the chorion fuse to the cells of the allantois.
	GO:0030198	extracellular matrix organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of an extracellular matrix.
	GO:0002041	intussusceptive angiogenesis	The formation of new blood vessels as a result of the insertion and extension of lumenal tissue pillars.
	GO:0060716	labyrinthine layer blood vessel development	The process whose specific outcome is the progression of a blood vessel of the labyrinthine layer of the placenta over time, from its formation to the mature structure. The embryonic vessels grow through the layer to come in close contact with the maternal blood supply.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0060548	negative regulation of cell death	Any process that decreases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:0001649	osteoblast differentiation	The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
	GO:0030513	positive regulation of BMP signaling pathway	Any process that activates or increases the frequency, rate or extent of BMP signaling pathway activity.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0061036	positive regulation of cartilage development	Any process that increases the rate, frequency, or extent of cartilage development, the process whose specific outcome is the progression of the cartilage over time, from its formation to the mature structure. Cartilage is a connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
	GO:0045597	positive regulation of cell differentiation	Any process that activates or increases the frequency, rate or extent of cell differentiation.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0010811	positive regulation of cell-substrate adhesion	Any process that increases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
	GO:2000304	positive regulation of ceramide biosynthetic process	Any process that activates or increases the frequency, rate or extent of ceramide biosynthetic process.
	GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that activates or increases the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0045669	positive regulation of osteoblast differentiation	Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
	GO:0033690	positive regulation of osteoblast proliferation	Any process that activates or increases the rate or extent of osteoblast proliferation.
	GO:0010518	positive regulation of phospholipase activity	Any process that increases the frequency, rate or extent of phospholipase activity, the hydrolysis of a phospholipid.
	GO:0045860	positive regulation of protein kinase activity	Any process that activates or increases the frequency, rate or extent of protein kinase activity.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0072593	reactive oxygen species metabolic process	The chemical reactions and pathways involving a reactive oxygen species, any molecules or ions formed by the incomplete one-electron reduction of oxygen. They contribute to the microbicidal activity of phagocytes, regulation of signal transduction and gene expression, and the oxidative damage to biopolymers.
	GO:0070372	regulation of ERK1 and ERK2 cascade	Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0001558	regulation of cell growth	Any process that modulates the frequency, rate, extent or direction of cell growth.
	GO:0016337	single organismal cell-cell adhesion	The attachment of one cell to another cell via adhesion molecules, where both cells are part of the same organism.
	GO:0003281	ventricular septum development	The progression of the ventricular septum over time from its formation to the mature structure.
	GO:0044319	wound healing, spreading of cells	The migration of a cell along or through a wound gap that contributes to the reestablishment of a continuous surface.
cellular component
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005578	proteinaceous extracellular matrix	A layer consisting mainly of proteins (especially collagen) and glycosaminoglycans (mostly as proteoglycans) that forms a sheet underlying or overlying cells such as endothelial and epithelial cells. The proteins are secreted by cells in the vicinity. An example of this component is found in Mus musculus.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 16)

Sites (16, 16)

SS Bonds (25, 25)

Cis Peptide Bonds (7, 7)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 10)

PROSITE Motifs (1, 5)

Exons (15, 80)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (68, 97)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File