Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURAL STUDIES OF A POTASSIUM CHANNEL / CHARYBDOTOXIN COMPLEX
 
Authors :  L. Yu, C. Sun, D. Song, J. Shen, N. Xu, A. Gunasekera, P. J. Hajduk, E. T. Olejniczak
Date :  11 Jul 05  (Deposition) - 10 Jan 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B,C,D,E
Keywords :  Potassium Channel, Kcsa, Nmr, Structure, Membrane Protein, Metal Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Yu, C. Sun, D. Song, J. Shen, N. Xu, A. Gunasekera, P. J. Hajduk, E. T. Olejniczak
Nuclear Magnetic Resonance Structural Studies Of A Potassium Channel-Charybdotoxin Complex.
Biochemistry V. 44 15834 2005
PubMed-ID: 16313186  |  Reference-DOI: 10.1021/BI051656D
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - VOLTAGE-GATED POTASSIUM CHANNEL
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPIVEX-D2.4D
    Expression System StrainC41 (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneKCSA, SKC1
    MutationYES
    Organism ScientificSTREPTOMYCES LIVIDANS
    Organism Taxid1916
 
Molecule 2 - CHARYBDOTOXIN
    ChainsE
    EngineeredYES
    SyntheticYES

 Structural Features

(-) Chains, Units

  
NMR Structure 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1PCA1Mod. Amino AcidPYROGLUTAMIC ACID

(-) Sites  (0, 0)

(no "Site" information available for 2A9H)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1E:807 -E:828
2E:813 -E:833
3E:817 -E:835

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2A9H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A9H)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCORP_SHORT_TOXINPS01138 Scorpion short toxins signature.KAX11_LEIQH35-57  1E:813-835

(-) Exons   (0, 0)

(no "Exon" information available for 2A9H)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:97
 aligned with KCSA_STRLI | P0A334 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:97
                                    32        42        52        62        72        82        92       102       112       
           KCSA_STRLI    23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQ 119
               SCOP domains d2a9ha1 A:23-119 Potassium channel protein                                                        SCOP domains
               CATH domains 2a9hA00 A:23-119  [code=1.10.287.70, no name defined]                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2a9h A  23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ 119
                                    32        42        52        62        72        82        92       102       112       

Chain B from PDB  Type:PROTEIN  Length:97
 aligned with KCSA_STRLI | P0A334 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:97
                                    32        42        52        62        72        82        92       102       112       
           KCSA_STRLI    23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQ 119
               SCOP domains d2a9hb_ B: Potassium channel protein                                                              SCOP domains
               CATH domains 2a9hB00 B:23-119  [code=1.10.287.70, no name defined]                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2a9h B  23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ 119
                                    32        42        52        62        72        82        92       102       112       

Chain C from PDB  Type:PROTEIN  Length:97
 aligned with KCSA_STRLI | P0A334 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:97
                                    32        42        52        62        72        82        92       102       112       
           KCSA_STRLI    23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQ 119
               SCOP domains d2a9hc_ C: Potassium channel protein                                                              SCOP domains
               CATH domains 2a9hC00 C:23-119  [code=1.10.287.70, no name defined]                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2a9h C  23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ 119
                                    32        42        52        62        72        82        92       102       112       

Chain D from PDB  Type:PROTEIN  Length:97
 aligned with KCSA_STRLI | P0A334 from UniProtKB/Swiss-Prot  Length:160

    Alignment length:97
                                    32        42        52        62        72        82        92       102       112       
           KCSA_STRLI    23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQ 119
               SCOP domains d2a9hd_ D: Potassium channel protein                                                              SCOP domains
               CATH domains 2a9hD00 D:23-119  [code=1.10.287.70, no name defined]                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 2a9h D  23 ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQ 119
                                    32        42        52        62        72        82        92       102       112       

Chain E from PDB  Type:PROTEIN  Length:37
 aligned with KAX11_LEIQH | P13487 from UniProtKB/Swiss-Prot  Length:59

    Alignment length:37
                                    32        42        52       
          KAX11_LEIQH    23 QFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS  59
               SCOP domains d2a9he1 E:801-837 Charybdotoxin       SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------SCORP_SHORT_TOXIN      -- PROSITE
                 Transcript ------------------------------------- Transcript
                 2a9h E 801 xFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS 837
                            |      810       820       830       
                            |                                    
                          801-PCA                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 5)

NMR Structure

(-) CATH Domains  (1, 4)

NMR Structure

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A9H)

(-) Gene Ontology  (17, 17)

NMR Structure(hide GO term definitions)
Chain A,B,C,D   (KCSA_STRLI | P0A334)
molecular function
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005249    voltage-gated potassium channel activity    Enables the transmembrane transfer of a potassium ion by a voltage-gated channel. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
biological process
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0071805    potassium ion transmembrane transport    A process in which a potassium ion is transported from one side of a membrane to the other.
    GO:0006813    potassium ion transport    The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0008076    voltage-gated potassium channel complex    A protein complex that forms a transmembrane channel through which potassium ions may cross a cell membrane in response to changes in membrane potential.

Chain E   (KAX11_LEIQH | P13487)
molecular function
    GO:0008200    ion channel inhibitor activity    Stops, prevents, or reduces the activity of an ion channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0042742    defense response to bacterium    Reactions triggered in response to the presence of a bacterium that act to protect the cell or organism.
    GO:0050832    defense response to fungus    Reactions triggered in response to the presence of a fungus that act to protect the cell or organism.
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PCA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2a9h)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2a9h)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a9h
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KAX11_LEIQH | P13487
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  KCSA_STRLI | P0A334
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KAX11_LEIQH | P13487
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  KCSA_STRLI | P0A334
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KAX11_LEIQH | P134871bah 1cmr 2crd 4jta 4jtc 4jtd
        KCSA_STRLI | P0A3341bl8 1f6g 1j95 1jq1 1jq2 1jvm 1k4c 1k4d 1r3i 1r3j 1r3k 1r3l 1s33 1s5h 1zwi 2atk 2bob 2boc 2dwd 2dwe 2h8p 2hg5 2hjf 2hvj 2hvk 2ih1 2ih3 2itc 2itd 2jk5 2nlj 2p7t 2qto 2w0f 3eff 3f5w 3f7v 3f7y 3fb5 3fb6 3fb7 3fb8 3gb7 3hpl 3ifx 3iga 3ogc 3or6 3or7 3pjs 3stl 3stz 4lbe 4lcu 4msw 4uuj 5e1a 5ebl 5ebm 5ebw 5ec1 5ec2 5j9p

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2A9H)