1XUL - JenaLib

Theoretical Model (Jmol Viewer)

Title :   THEORETICAL MODEL OF THE LIGAND-BINDING REGION OF LUTROPIN RECEPTOR COMPLEXED WITH HUMAN CHORIONIC GONADOTROPIN

Authors :   X. Jiang, M. Dreano, D. R. Buckler, S. Cheng, A. Ythier, H. Wu, W. A. Hendrickson, N. El Tayar

Date :   27 Dec 96 (Deposition) - 15 May 97 (Release) - 15 May 97 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A,B,C

Keywords :   Complex (Hormone/Receptor), Glycoprotein Hormone Receptor, Glycoprotein, Phosphorylation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. Jiang, M. Dreano, D. R. Buckler, S. Cheng, A. Ythier, H. Wu, W. A. Hendrickson, N. El Tayar
Structural Predictions For The Ligand-Binding Region Of Glycoprotein Hormone Receptors And The Nature Of Hormone-Receptor Interactions Structure
Structure (London) V. 3 1341 1996
PubMed: search
(for further references see the PDB file header)

Molecule 1 - CHORIONIC GONADOTROPIN
	Chains	:	A
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS

Molecule 2 - CHORIONIC GONADOTROPIN
	Chains	:	B
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS

Molecule 3 - LUTROPIN RECEPTOR
	Chains	:	C
	Fragment	:	RESIDUES 51 - 232
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Synonym	:	HUMAN CHORIONIC GONADOTROPIN RECEPTOR


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

Theoretical Model (1, 2)

No.	Name	Count	Type	Full Name
1	NAG	2	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

(no "Site" information available for 1XUL)

Theoretical Model

No.	Residues
1	A:7	-	A:31
2	A:10	-	A:60
3	A:28	-	A:82
4	A:32	-	A:84
5	A:59	-	A:87
6	B:9	-	B:57
7	B:23	-	B:72
8	B:26	-	B:110
9	B:34	-	B:88
10	B:38	-	B:90
11	B:93	-	B:100
12	C:131	-	C:156

Theoretical Model

No.	Residues
1	Leu B:49	-	Pro B:50

Theoretical Model (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014586	K	22	R	CGB3_HUMAN	Polymorphism	6518	B	K	2	R
2	UniProt	VAR_015232	P	24	M	CGB3_HUMAN	Unclassified	---	B	P	4	M
3	UniProt	VAR_015233	R	28	W	CGB3_HUMAN	Polymorphism	---	B	R	8	W
4	UniProt	VAR_015234	R	30	H	CGB3_HUMAN	Polymorphism	201373221	B	R	10	H
5	UniProt	VAR_014587	T	35	I	CGB3_HUMAN	Polymorphism	6515	B	T	15	I
6	UniProt	VAR_014588	N	97	D	CGB3_HUMAN	Polymorphism	6519	B	N	77	D
7	UniProt	VAR_010154	C	131	R	LSHR_HUMAN	Disease (LHR)	121912527	C	C	131	R
8	UniProt	VAR_062336	V	144	F	LSHR_HUMAN	Disease (LHR)	121912539	C	V	144	F
9	UniProt	VAR_062337	I	152	T	LSHR_HUMAN	Disease (LHR)	---	C	I	152	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (5, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GLYCO_HORMONE_ALPHA_3	PS50277	Glycoprotein hormones alpha chain family profile.	GLHA_HUMAN	31-116	1	A:7-89
2	GLYCO_HORMONE_ALPHA_1	PS00779	Glycoprotein hormones alpha chain signature 1.	GLHA_HUMAN	52-64	1	A:28-40
3	GLYCO_HORMONE_BETA_1	PS00261	Glycoprotein hormones beta chain signature 1.	CGB3_HUMAN	54-60	1	B:34-40
3	GLYCO_HORMONE_BETA_1	PS00261	Glycoprotein hormones beta chain signature 1.	CGB7_HUMAN	54-60	1	B:34-40
4	GLYCO_HORMONE_ALPHA_2	PS00780	Glycoprotein hormones alpha chain signature 2.	GLHA_HUMAN	102-115	1	A:78-89
5	GLYCO_HORMONE_BETA_2	PS00689	Glycoprotein hormones beta chain signature 2.	CGB3_HUMAN	103-130	1	B:83-110
5	GLYCO_HORMONE_BETA_2	PS00689	Glycoprotein hormones beta chain signature 2.	CGB7_HUMAN	103-130	1	B:83-110

Theoretical Model (12, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000294954	1c	ENSE00001894530	chr2:48982832-48982650	183	LSHR_HUMAN	1-54	54	1	C:51-54	4
1.2	ENST00000294954	2	ENSE00001069341	chr2:48958437-48958366	72	LSHR_HUMAN	54-78	25	1	C:54-78	25
1.3	ENST00000294954	3	ENSE00001069335	chr2:48956366-48956292	75	LSHR_HUMAN	78-103	26	1	C:78-103	26
1.4	ENST00000294954	4	ENSE00001069343	chr2:48952889-48952815	75	LSHR_HUMAN	103-128	26	1	C:103-128	26
1.5	ENST00000294954	5	ENSE00001069336	chr2:48950835-48950761	75	LSHR_HUMAN	128-153	26	1	C:128-153	26
1.6a	ENST00000294954	6a	ENSE00001069339	chr2:48950672-48950595	78	LSHR_HUMAN	153-179	27	1	C:153-179	27
1.8	ENST00000294954	8	ENSE00001069344	chr2:48941193-48941125	69	LSHR_HUMAN	179-202	24	1	C:179-202	24
1.9a	ENST00000294954	9a	ENSE00001069333	chr2:48936161-48936087	75	LSHR_HUMAN	202-227	26	1	C:202-227	26
1.10a	ENST00000294954	10a	ENSE00000809863	chr2:48925939-48925754	186	LSHR_HUMAN	227-289	63	1	C:227-232	6
1.11	ENST00000294954	11	ENSE00001726615	chr2:48921443-48921363	81	LSHR_HUMAN	289-316	28	0	-	-
1.12b	ENST00000294954	12b	ENSE00001925227	chr2:48915988-48913969	2020	LSHR_HUMAN	316-699	384	0	-	-

2.1	ENST00000369582	1	ENSE00001450387	chr6:87804824-87804731	94	GLHA_HUMAN	-	0	0	-	-
2.2	ENST00000369582	2	ENSE00000798150	chr6:87797925-87797831	95	GLHA_HUMAN	1-30	30	1	A:5-6	2
2.3	ENST00000369582	3	ENSE00000798149	chr6:87796152-87795968	185	GLHA_HUMAN	30-91	62	1	A:6-67	62
2.4	ENST00000369582	4	ENSE00000798148	chr6:87795551-87795216	336	GLHA_HUMAN	92-116	25	1	A:68-89	22

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:85
 aligned with GLHA_HUMAN | P01215 from UniProtKB/Swiss-Prot  Length:116

    Alignment length:85
                                    38        48        58        68        78        88        98       108     
           GLHA_HUMAN    29 QDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYY 113
               SCOP domains ------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee...........eeeeeeeeeeeee..hhhhh.......eeeee.eeeeeeeeeee.....eeeee.eeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --GLYCO_HORMONE_ALPHA_3  PDB: A:7-89 UniProt: 31-116                                  PROSITE (1)
                PROSITE (2) -----------------------GLYCO_HORMONE-------------------------------------GLYCO_HORMON PROSITE (2)
           Transcript 2 (1) 2.-------------------------------------------------------------Exon 2.4  PDB: A:68-89 Transcript 2 (1)
           Transcript 2 (2) -Exon 2.3  PDB: A:6-67 UniProt: 30-91                          ---------------------- Transcript 2 (2)
                 1xul A   5 QDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYY  89
                                    14        24        34        44        54        64        74        84

Chain B from PDB  Type:PROTEIN  Length:110
 aligned with CGB3_HUMAN | P0DN86 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:110
                                    31        41        51        61        71        81        91       101       111       121       131
           CGB3_HUMAN    22 KEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCD 131
               SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeeee........eeeeeeeeeeeeee..............eeeeee.eeeeeee..........eeeeeee.eeeeee.....eeeee......... Sec.struct. author
                 SAPs(SNPs) R-M---W-H----I-------------------------------------------------------------D---------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------GLYCO_HORMONE_BETA_2        - PROSITE (3)
                PROSITE (4) --------------------------------GLYCO_H----------------------------------------------------------------------- PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1xul B   2 KEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCD 111
                                    11        21        31        41        51        61        71        81        91       101       111

Chain B from PDB  Type:PROTEIN  Length:110
 aligned with CGB7_HUMAN | P0DN87 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:110
                                    31        41        51        61        71        81        91       101       111       121       131
           CGB7_HUMAN    22 REMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCD 131
               SCOP domains -------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeeee........eeeeeeeeeeeeee..............eeeeee.eeeeeee..........eeeeeee.eeeeee.....eeeee......... Sec.struct. author
                 SAPs(SNPs) R-M---W-H----I-------------------------------------------------------------D---------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------GLYCO_H----------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------GLYCO_HORMONE_BETA_2        - PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 1xul B   2 KEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCD 111
                                    11        21        31        41        51        61        71        81        91       101       111

Chain C from PDB  Type:PROTEIN  Length:182
 aligned with LSHR_HUMAN | P22888 from UniProtKB/Swiss-Prot  Length:699

    Alignment length:182
                                    60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230  
           LSHR_HUMAN    51 LTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISST 232
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...........hhh.......eee......................eee............hhh.......eee........hhhhhhhh......eee.......................eee....................eee............hhh.......eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------R------------F-------T-------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1c-----------------------Exon 1.3  PDB: C:78-103   ------------------------Exon 1.5  PDB: C:128-153  -------------------------Exon 1.8  PDB: C:179-202------------------------1.10a  Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.2  PDB: C:54-78   ------------------------Exon 1.4  PDB: C:103-128  ------------------------Exon 1.6a  PDB: C:153-179  ----------------------Exon 1.9a  PDB: C:202-227 ----- Transcript 1 (2)
                 1xul C  51 LTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISST 232
                                    60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1XUL)

(no "CATH Domain" information available for 1XUL)

(no "Pfam Domain" information available for 1XUL)

Theoretical Model(hide GO term definitions)

Chain A (GLHA_HUMAN | P01215)

molecular function
	GO:0005179	hormone activity	The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0016486	peptide hormone processing	The generation of a mature peptide hormone by posttranslational processing of a prohormone.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005796	Golgi lumen	The volume enclosed by the membranes of any cisterna or subcompartment of the Golgi apparatus, including the cis- and trans-Golgi networks.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B (CGB3_HUMAN | P0DN86)

molecular function
	GO:0005179	hormone activity	The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain B (CGB7_HUMAN | P0DN87)

molecular function
	GO:0005179	hormone activity	The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Chain C (LSHR_HUMAN | P22888)

molecular function
	GO:0008528	G-protein coupled peptide receptor activity	Combining with a peptide and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
	GO:0004930	G-protein coupled receptor activity	Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
	GO:0038106	choriogonadotropin hormone binding	Interacting selectively and non-covalently with choriogonadotropin hormone, a heterodimer, with an alpha subunit identical to that of luteinizing hormone (LH), follicle-stimulating hormone (FSH) and thyroid-stimulating hormone (TSH), and a unique beta subunit.
	GO:0035472	choriogonadotropin hormone receptor activity	Combining with the choriogonadotropin hormone to initiate a change in cell activity.
	GO:0004964	luteinizing hormone receptor activity	Combining with luteinizing hormone (also called lutropin) to initiate a change in cell activity.
	GO:0016500	protein-hormone receptor activity	Combining with a protein hormone to initiate a change in cell activity.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0007187	G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds with activation or inhibition of a nucleotide cyclase activity and a subsequent change in the concentration of a cyclic nucleotide.
	GO:0007190	activation of adenylate cyclase activity	Any process that initiates the activity of the inactive enzyme adenylate cyclase.
	GO:0007189	adenylate cyclase-activating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation of adenylyl cyclase activity and a subsequent increase in the concentration of cyclic AMP (cAMP).
	GO:0071371	cellular response to gonadotropin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gonadotropin stimulus.
	GO:0050890	cognition	The operation of the mind by which an organism becomes aware of objects of thought or perception; it includes the mental activities associated with thinking, learning, and memory.
	GO:0009755	hormone-mediated signaling pathway	A series of molecular signals mediated by the detection of a hormone.
	GO:0042700	luteinizing hormone signaling pathway	The series of molecular signals mediated by luteinizing hormone.
	GO:0030539	male genitalia development	The process whose specific outcome is the progression of the male genitalia over time, from its formation to the mature structure.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0022602	ovulation cycle process	A process involved in the sexual cycle seen in females, often with physiologic changes in the endometrium that recur at regular intervals during the reproductive years.
	GO:0007200	phospholipase C-activating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds with activation of phospholipase C (PLC) and a subsequent increase in the concentration of inositol trisphosphate (IP3) and diacylglycerol (DAG).
	GO:0043950	positive regulation of cAMP-mediated signaling	Any process which activates, maintains or increases the frequency, rate or extent of cAMP-mediated signaling, a series of molecular signals in which a cell uses cyclic AMP to convert an extracellular signal into a response.
	GO:0032962	positive regulation of inositol trisphosphate biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of inositol trisphosphate.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1xul)

	Cis Peptide Bonds
		Leu B:49 - Pro B:50	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1xul
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CGB3_HUMAN \| P0DN86
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CGB7_HUMAN \| P0DN87
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	GLHA_HUMAN \| P01215
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	LSHR_HUMAN \| P22888
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	238320
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CGB3_HUMAN \| P0DN86
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CGB7_HUMAN \| P0DN87
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	GLHA_HUMAN \| P01215
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	LSHR_HUMAN \| P22888
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CGB3_HUMAN \| P0DN86	:	1hcn 1hrp 1qfw
	CGB7_HUMAN \| P0DN87	:	1hcn 1hrp 1qfw
	GLHA_HUMAN \| P01215	:	1dz7 1e9j 1fl7 1hcn 1hd4 1hrp 1qfw 1xwd 4ay9 4mqw
	LSHR_HUMAN \| P22888	:	1lut

(no "Related Entries Specified in the PDB File" available for 1XUL)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (0, 0)

SS Bonds (12, 12)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 9)

PROSITE Motifs (5, 5)

Exons (12, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (36, 41)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File