|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1R23) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1R23) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1R23) |
PROSITE Motifs (2, 4)
Asymmetric/Biological Unit (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1R23) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:104 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot Length:122 Alignment length:104 27 37 47 57 67 77 87 97 107 117 SMTB_SYNE7 18 HAAIASELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121 SCOP domains d1r23a_ A: SmtB repressor SCOP domains CATH domains 1r23A00 A:18-121 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------HTH_ARSR_2 PDB: A:28-121 UniProt: 28-122 PROSITE (1) PROSITE (2) -------------------------------------------HTH_ARSR_1 ------------------------------------------ PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------- Transcript 1r23 A 18 HAAIASELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121 27 37 47 57 67 77 87 97 107 117 Chain B from PDB Type:PROTEIN Length:97 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot Length:122 Alignment length:97 34 44 54 64 74 84 94 104 114 SMTB_SYNE7 25 LQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121 SCOP domains d1r23b_ B: SmtB repressor SCOP domains CATH domains 1r23B00 B:25-121 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --------------------HTH_5-1r23B01 B:45-91 ------------------------------ Pfam domains (1) Pfam domains (2) --------------------HTH_5-1r23B02 B:45-91 ------------------------------ Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---HTH_ARSR_2 PDB: B:28-121 UniProt: 28-122 PROSITE (1) PROSITE (2) ------------------------------------HTH_ARSR_1 ------------------------------------------ PROSITE (2) Transcript ------------------------------------------------------------------------------------------------- Transcript 1r23 B 25 LQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121 34 44 54 64 74 84 94 104 114
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SMTB_SYNE7 | P30340)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|