![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1R22) |
(no "Cis Peptide Bond" information available for 1R22) |
(no "SAP(SNP)/Variant" information available for 1R22) |
Asymmetric/Biological Unit (2, 4)
|
(no "Exon" information available for 1R22) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:93 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot Length:122 Alignment length:97 34 44 54 64 74 84 94 104 114 SMTB_SYNE7 25 LQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121 SCOP domains d1r22a_ A: SmtB repressor SCOP domains CATH domains 1r22A00 A:25-121 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ---HTH_ARSR_2 PDB: A:28-120 UniProt: 28-122 PROSITE (1) PROSITE (2) ------------------------------------HTH_ARSR_1 ------------------------------------------ PROSITE (2) Transcript ------------------------------------------------------------------------------------------------- Transcript 1r22 A 25 LQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELSVGDLAQAIGVSESAVSHQLRSLRNLRLVSYR----HVYYQLQDHHIVALYQNALDHLQES 121 34 44 54 64 74 84 | - | 104 114 92 97 Chain B from PDB Type:PROTEIN Length:97 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot Length:122 Alignment length:97 35 45 55 65 75 85 95 105 115 SMTB_SYNE7 26 QAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQECR 122 SCOP domains d1r22b_ B: SmtB repressor SCOP domains CATH domains 1r22B00 B:26-122 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) -------------------HTH_5-1r22B01 B:45-91 ------------------------------- Pfam domains (1) Pfam domains (2) -------------------HTH_5-1r22B02 B:45-91 ------------------------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --HTH_ARSR_2 PDB: B:28-122 UniProt: 28-122 PROSITE (1) PROSITE (2) -----------------------------------HTH_ARSR_1 ------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------- Transcript 1r22 B 26 QAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELSVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQESR 122 35 45 55 65 75 85 95 105 115
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SMTB_SYNE7 | P30340)
|
|
|
|
|
|
|