Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  SMTB REPRESSOR FROM SYNECHOCOCCUS PCC7942
 
Authors :  W. J. Cook, L. M. Hall
Date :  16 Sep 97  (Deposition) - 03 Dec 97  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Metalloregulation, Dna Repressor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. J. Cook, S. R. Kar, K. B. Taylor, L. M. Hall
Crystal Structure Of The Cyanobacterial Metallothionein Repressor Smtb: A Model For Metalloregulatory Proteins.
J. Mol. Biol. V. 275 337 1998
PubMed-ID: 9466913  |  Reference-DOI: 10.1006/JMBI.1997.1443

(-) Compounds

Molecule 1 - TRANSCRIPTIONAL REPRESSOR SMTB
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: SYNECHOCOCCUS ELONGATUS
    Organism Taxid: 1140
    Strain: PCC 7942

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SMT)

(-) Sites  (0, 0)

(no "Site" information available for 1SMT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SMT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SMT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SMT)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_ARSR_2PS50987 ArsR-type HTH domain profile.SMTB_SYNE728-122
 		  2A:28-121
B:28-120
2HTH_ARSR_1PS00846 Bacterial regulatory proteins, arsR family signature.SMTB_SYNE761-79
 		  2A:61-79
B:61-79

(-) Exons   (0, 0)

(no "Exon" information available for 1SMT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:98
 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:98
                                    33        43        53        63        73        83        93       103       113        
           SMTB_SYNE7    24 ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121
               SCOP domains d1smta_ A: SmtB repressor                                                                          SCOP domains
               CATH domains 1smtA00 A:24-121 'winged helix' repressor DNA binding domain                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhh..hhhhhhhhhh......hhhhhhhh...hhhhhhhhhhhhh...eeeee....eeeee..hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----HTH_ARSR_2  PDB: A:28-121 UniProt: 28-122                                                      PROSITE (1)
                PROSITE (2) -------------------------------------HTH_ARSR_1         ------------------------------------------ PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                 1smt A  24 ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121
                                    33        43        53        63        73        83        93       103       113        


Chain B from PDB  Type:PROTEIN  Length:101
 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:101
                                    29        39        49        59        69        79        89        99       109       119 
           SMTB_SYNE7    20 AIASELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQE 120
               SCOP domains d1smtb_ B: SmtB repressor                                                                             SCOP domains
               CATH domains 1smtB00 B:20-120 'winged helix' repressor DNA binding domain                                          CATH domains
           Pfam domains (1) -------------------------HTH_5-1smtB01 B:45-91                          ----------------------------- Pfam domains (1)
           Pfam domains (2) -------------------------HTH_5-1smtB02 B:45-91                          ----------------------------- Pfam domains (2)
         Sec.struct. author ..........hhhhhhhhhhhhhh..hhhhhhhhhh......hhhhhhhh...hhhhhhhhhhhhh...eeeeee..eeeeee..hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------HTH_ARSR_2  PDB: B:28-120 UniProt: 28-122                                                     PROSITE (1)
                PROSITE (2) -----------------------------------------HTH_ARSR_1         ----------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 1smt B  20 AIASELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQE 120
                                    29        39        49        59        69        79        89        99       109       119
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (SMTB_SYNE7 | P30340)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1smt)
 
  Sites
(no "Sites" information available for 1smt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1smt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1smt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SMTB_SYNE7 | P30340
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SMTB_SYNE7 | P30340
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SMTB_SYNE7 | P30340: 1r1t 1r22 1r23

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SMT)