|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1R1T) |
(no "Site" information available for 1R1T) |
(no "SS Bond" information available for 1R1T) |
(no "Cis Peptide Bond" information available for 1R1T) |
(no "SAP(SNP)/Variant" information available for 1R1T) |
Asymmetric/Biological Unit (2, 4)
|
(no "Exon" information available for 1R1T) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:98 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot Length:122 Alignment length:98 33 43 53 63 73 83 93 103 113 SMTB_SYNE7 24 ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121 SCOP domains d1r1ta_ A: SmtB repressor SCOP domains CATH domains 1r1tA00 A:24-121 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----HTH_ARSR_2 PDB: A:28-121 UniProt: 28-122 PROSITE (1) PROSITE (2) -------------------------------------HTH_ARSR_1 ------------------------------------------ PROSITE (2) Transcript -------------------------------------------------------------------------------------------------- Transcript 1r1t A 24 ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC 121 33 43 53 63 73 83 93 103 113 Chain B from PDB Type:PROTEIN Length:99 aligned with SMTB_SYNE7 | P30340 from UniProtKB/Swiss-Prot Length:122 Alignment length:99 29 39 49 59 69 79 89 99 109 SMTB_SYNE7 20 AIASELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHL 118 SCOP domains d1r1tb_ B: SmtB repressor SCOP domains CATH domains 1r1tB00 B:20-118 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) -------------------------HTH_5-1r1tB01 B:45-91 --------------------------- Pfam domains (1) Pfam domains (2) -------------------------HTH_5-1r1tB02 B:45-91 --------------------------- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --------HTH_ARSR_2 PDB: B:28-118 UniProt: 28-122 PROSITE (1) PROSITE (2) -----------------------------------------HTH_ARSR_1 --------------------------------------- PROSITE (2) Transcript --------------------------------------------------------------------------------------------------- Transcript 1r1t B 20 AIASELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHL 118 29 39 49 59 69 79 89 99 109
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SMTB_SYNE7 | P30340)
|
|
|
|
|
|
|